CAT-VL6RIZ6YY

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesFelis catus LocusIGL TypeV FunctionalNone Length284 nt

IGLV3-9*01: a Felis catus IGL V allele sequence, 284 nt, not recorded. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Felis catus (NCBITAXON:9685)
Locus / type	IGL / V
Functional i	None
Length	284 nt
Protein UID i	CAT-VP-ON2EJH (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

284 nt

TCCTATGTGCTCACTCAGCCCCCGTCCGTGTCAGTGAACCTGGGACAGACGGCCAGGATCACGTGTGGAGGAAACAACATTGGAAGTTATTATGCTTACTGGTACCAGCAGAAGTCAGGCCAGGCCCCTGTGCTGATTATCTATGAGGACAGCAAACGGCCCTCAGGGATCCCTGACCGATTCTCAGGCACCAACTCGGGGAACACGGCCACCCTGACCATCAGCGGGGCCGGGCCGAGGACGAGGCTGACTATTACTGTCAGGTGTGGGACAGTGGTAATGCT

Amino-acid sequence (V-REGION)

94 aa

SYVLTQPPSVSVNLGQTARITCGGNNIGSYYAYWYQQKSGQAPVLIIYEDSKRPSGIPDRFSGTNSGNTATLTISGAGPRTRLTITVRCGTVVM

Translated here from the nucleotide sequence; no source published a protein for this allele. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (CAT-VL6RIZ6YY). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGLV3-9*01	IMGT	IMGT

External records i

IMGT: IGLV3-9*01

Literature references 17 total · 17 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
25338678	Sequencing of the human IG light chain loci from a hydatidiform mole BAC library reveals locus-specific signatures of genetic diversity.	name mentioned^*	literature_supp
29558968	BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data.	name mentioned^*	literature_supp
31839985	More than one antibody of individual B cells revealed by single-cell immune profiling.	name mentioned^*	literature_supp
33048842	Antimalarial antibody repertoire defined by plasma IG proteomics and single B cell IG sequencing.	name mentioned^*	literature_supp
33485405	Enhancement versus neutralization by SARS-CoV-2 antibodies from a convalescent donor associates with distinct epitopes on the RBD.	name mentioned^*	literature_supp
34126625	Naturally enhanced neutralizing breadth against SARS-CoV-2 one year after infection.	name mentioned^*	literature_supp
34587480	Paired heavy- and light-chain signatures contribute to potent SARS-CoV-2 neutralization in public antibody responses.	name mentioned^*	literature_supp
35447092	Analysis of memory B cells identifies conserved neutralizing epitopes on the N-terminal domain of variant SARS-Cov-2 spike proteins.	name mentioned^*	literature_supp
35776090	Antibody evolution to SARS-CoV-2 after single-dose Ad26.COV2.S vaccine in humans.	name mentioned^*	literature_supp
36006380	Humoral immunity to SARS-CoV-2 elicited by combination COVID-19 vaccination regimens.	name mentioned^*	literature_supp
36149398	Memory B cell responses to Omicron subvariants after SARS-CoV-2 mRNA breakthrough infection in humans.	name mentioned^*	literature_supp
36827454	Modeling and predicting the overlap of B- and T-cell receptor repertoires in healthy and SARS-CoV-2 infected individuals.	name mentioned^*	literature_supp
38205245	Comprehensive characterization and database construction of immune repertoire in the largest Chinese glioma cohort.	name mentioned^*	literature_supp
38406579	AIRR-C IG Reference Sets: curated sets of immunoglobulin heavy and light chain germline genes.	name mentioned^*	literature_supp
38435425	Analysis of immunoglobulin/T-cell receptor repertoires by high-throughput RNA sequencing reveals a continuous dynamic of positive clonal selection in follicular lymphoma.	name mentioned^*	literature_supp
40664667	High-resolution mapping of single cells in spatial context.	name mentioned^*	literature_supp
41803327	IFN-gene signatures in B cells following influenza A and B virus infection and influenza vaccination.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGTGACACAGGCAGATGGGGAAGTGAGACACAAACC	IMGT	CAT-RAVKD4

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGGCCTGGACCCCTCTCCTCCTCGGCCTCCTCGCTCACTGCACAGGCTCCGTGGCC	46 + 11 nt	IMGT	CAT-LZKNZS

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/CAT-VL6RIZ6YY/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases