CAT-VLHCTJS7Q

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesFelis catus LocusTRA TypeV FunctionalTrue Length271 nt

TRAV25*01: a Felis catus TRA V allele sequence, 271 nt, functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Felis catus (NCBITAXON:9685)
Locus / type	TRA / V
Functional i	True
Length	271 nt
Protein UID i	CAT-VP-MNQPTX (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

271 nt

GGACAAGAGATAAAGCAAATTCCTCAATTCCTGCTTCTACAAGAAGGAGAGAACTTCACCATTTACTGCAATTCCTCAAGGACTTTAAACAGCTTACATTGGTATAAGCAGAGGCCTGGGGGCAGTCCCATCCTCTTGATCACCTTAGTTAAGAGTGGAGATGTGAAGCAGGAAAGACTGACAGCTTGGTTTGGAGACACCAGAAAGAACAGTTTGCTGCACATGGTGGCCACCCAGACTGCAGATTCAGGAGTCTATTTCTGCACAGGGG

Amino-acid sequence (V-REGION)

90 aa

GQEIKQIPQFLLLQEGENFTIYCNSSRTLNSLHWYKQRPGGSPILLITLVKSGDVKQERLTAWFGDTRKNSLLHMVATQTADSGVYFCTG

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (CAT-VLHCTJS7Q). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
TRAV25*01	IMGT	IMGT

External records i

IMGT: TRAV25*01

Literature references 15 total · 15 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
22792299	Unbiased analysis of TCRα/β chains at the single-cell level in human CD8+ T-cell subsets.	name mentioned^*	literature_supp
31237075	Comparative analysis of CDR3 regions in paired human αβ CD8 T cells.	name mentioned^*	literature_supp
32040512	Very rapid cloning, expression and identifying specificity of T-cell receptors for T-cell engineering.	name mentioned^*	literature_supp
36408799	SARS-CoV-2-specific CD4+ and CD8+ T cell responses can originate from cross-reactive CMV-specific T cells.	name mentioned^*	literature_supp
36603583	Improved predictions of antigen presentation and TCR recognition with MixMHCpred2.2 and PRIME2.0 reveal potent SARS-CoV-2 CD8+ T-cell epitopes.	name mentioned^*	literature_supp
36923729	Cross-reactivity influences changes in human influenza A virus and Epstein Barr virus specific CD8 memory T cell receptor alpha and beta repertoires between young and old.	name mentioned^*	literature_supp
37287989	Targeting KRASG12V mutations with HLA class II-restricted TCR for the immunotherapy in solid tumors.	name mentioned^*	literature_supp
38762584	Invariant γδTCR natural killer-like effector T cells in the naked mole-rat.	name mentioned^*	literature_supp
38871688	Germline-like TCR-α chains shared between autoreactive T cells in blood and pancreas.	name mentioned^*	literature_supp
39133650	Expansion of the HSV-2-specific T cell repertoire in skin after immunotherapeutic HSV-2 vaccine.	name mentioned^*	literature_supp
39421738	scRNA+TCR-seq reveals the pivotal role of dual receptor T lymphocytes in the pathogenesis of Kawasaki disease and during IVIG treatment.	name mentioned^*	literature_supp
40664667	High-resolution mapping of single cells in spatial context.	name mentioned^*	literature_supp
40866291	Spatial TCR clonality and clonal expansion in the in situ microenvironment of non-small cell lung cancer.	name mentioned^*	literature_supp
40877317	Molecular basis of potent antiviral HLA-C-restricted CD8+ T cell response to an immunodominant SARS-CoV-2 nucleocapsid epitope.	name mentioned^*	literature_supp
42125653	N-terminal pyroglutamylation of an HLA-A24-restricted immunodominant epitope enhances SARS-CoV-2-specific T-cell responses.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGTGCTCTCAGAGCACCTGCGACCTGTCCCCAAACC	IMGT	CAT-R2ATE6

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGTTACTTACAGTACCAATGTTGATCTTGTGGATGCAAATATCACAAGTGAAT	46 + 8 nt	IMGT	CAT-LERDIH

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/CAT-VLHCTJS7Q/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases