CHIMP-V5ACKAJBK

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesPan troglodytes LocusTRA TypeV FunctionalTrue Length263 nt

TRAV2*01: a Pan troglodytes TRA V allele sequence, 263 nt, functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Pan troglodytes (NCBITAXON:9598)
Locus / type	TRA / V
Functional i	True
Length	263 nt
Protein UID i	CHIMP-VP-7ZOVZ4 (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

263 nt

AAGGACCAAGTGTTTCAGCCTTCCACAGTGGCAACTTCGGAGGGAGCTGTTGTGGAAATCTTCTGTAATCACTCTGTGTCCAATGCTTACAACTTCTTCTGGTACCTTCACTTCCCGGGATGTGCACCAAGACTCCTTGTTAAAGGCTCAAAGCCTTCTCAGCAGGGACGATACAACATGACCTATGAACGGTTCTCTTCATCGCTGCTTATCCTCCAGGTGCGGGAGGCAGATGCTGCTGTTTACTACTGTGCTGTGGAGGA

Amino-acid sequence (V-REGION)

87 aa

KDQVFQPSTVATSEGAVVEIFCNHSVSNAYNFFWYLHFPGCAPRLLVKGSKPSQQGRYNMTYERFSSSLLILQVREADAAVYYCAVE

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (CHIMP-V5ACKAJBK). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
TRAV2*01	IMGT	IMGT

External records i

IMGT: TRAV2*01

Literature references 16 total · 16 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
22792299	Unbiased analysis of TCRα/β chains at the single-cell level in human CD8+ T-cell subsets.	name mentioned^*	literature_supp
27460926	Single-cell TCRseq: paired recovery of entire T-cell alpha and beta chain transcripts in T-cell receptors from single-cell RNAseq.	name mentioned^*	literature_supp
31237075	Comparative analysis of CDR3 regions in paired human αβ CD8 T cells.	name mentioned^*	literature_supp
32668259	CD4+ T Cells Recognize Conserved Influenza A Epitopes through Shared Patterns of V-Gene Usage and Complementary Biochemical Features.	name mentioned^*	literature_supp
32868763	Single-cell RNA sequencing identifies shared differentiation paths of mouse thymic innate T cells.	name mentioned^*	literature_supp
35436998	pmTR database: population matched (pm) germline allelic variants of T-cell receptor (TR) loci.	name mentioned^*	literature_supp
36408799	SARS-CoV-2-specific CD4+ and CD8+ T cell responses can originate from cross-reactive CMV-specific T cells.	name mentioned^*	literature_supp
38762584	Invariant γδTCR natural killer-like effector T cells in the naked mole-rat.	name mentioned^*	literature_supp
38871688	Germline-like TCR-α chains shared between autoreactive T cells in blood and pancreas.	name mentioned^*	literature_supp
39421738	scRNA+TCR-seq reveals the pivotal role of dual receptor T lymphocytes in the pathogenesis of Kawasaki disease and during IVIG treatment.	name mentioned^*	literature_supp
39472557	Physiological and pathogenic T cell autoreactivity converge in type 1 diabetes.	name mentioned^*	literature_supp
40664667	High-resolution mapping of single cells in spatial context.	name mentioned^*	literature_supp
40866291	Spatial TCR clonality and clonal expansion in the in situ microenvironment of non-small cell lung cancer.	name mentioned^*	literature_supp
41306962	Promiscuous class II-binding SARS-CoV-2-nuc derived vaccine-peptide induced extensive conventional, innate and unconventional T cell responses.	name mentioned^*	literature_supp
41766885	Correction: Promiscuous class II-binding SARS-CoV-2-nuc derived vaccine-peptide induced extensive conventional, innate and unconventional T cell responses.	name mentioned^*	literature_supp
42125653	N-terminal pyroglutamylation of an HLA-A24-restricted immunodominant epitope enhances SARS-CoV-2-specific T-cell responses.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGAGGCAGGGAACCCATGAAGAGCTGAACAGAAACA	IMGT	CHIMP-RERUQD

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGGCTTTGCAGAGCACTCTGGGGGCGGTGTGGCTAGGGCTTCTCCTCAACTCTCTCTGGAAGGTTGCAGAAAGC	64 + 11 nt	IMGT	CHIMP-LTKUYA

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/CHIMP-V5ACKAJBK/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases