COW-VJ3RF6EAH

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesBos taurus LocusIGH TypeV FunctionalNone Length287 nt

IGHV2-5*02: a Bos taurus IGH V allele sequence, 287 nt, not recorded. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Bos taurus (NCBITAXON:9913)
Locus / type	IGH / V
Functional i	None
Length	287 nt
Protein UID i	COW-VP-DQ54DF (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

287 nt

CAGATGAGCTGCAGCAGTCGGGCCAGAACTGGTGAACCCTCACTCACCCTCTCCTGACGTGCACTGTCTCTTCTTACTCCATCACGTGGTTATTGTCGGAACTGGATTCGCCAGGCCCTAGGGAAGGGGCTAGAGCAGATGTCATAAATAAGCTATGATGGTGACACTTACTACAGCCCCTGCATCAAGATCACACCTCCATCTGCAGAGACATCCAAGAATCAGTTCTCTCTGCAGCTGAGCTCTGTGACCACTGAGGACACGGCAGTGTGCTGCTAGGCAAGAGA

Amino-acid sequence (V-REGION)

95 aa

QMSCSSRARTGEPSLTLS*RALSLLTPSRGYCRNWIRQALGKGLEQMS*ISYDGDTYYSPCIKITPPSAETSKNQFSLQLSSVTTEDTAVCC*AR

Translated here from the nucleotide sequence; no source published a protein for this allele. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (COW-VJ3RF6EAH). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV2-5*02	IMGT	IMGT

External records i

IMGT: IGHV2-5*02

Literature references 25 total · 25 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
27423190	A Single Human Papillomavirus Vaccine Dose Improves B Cell Memory in Previously Infected Subjects.	name mentioned^*	literature_supp
29558968	BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data.	name mentioned^*	literature_supp
30697215	VH1-69 Utilizing Antibodies Are Capable of Mediating Non-neutralizing Fc-Mediated Effector Functions Against the Transmitted/Founder gp120.	name mentioned^*	literature_supp
31839985	More than one antibody of individual B cells revealed by single-cell immune profiling.	name mentioned^*	literature_supp
31974198	Genomic arrays identify high-risk chronic lymphocytic leukemia with genomic complexity: a multi-center study.	name mentioned^*	literature_supp
32636395	IgCaller for reconstructing immunoglobulin gene rearrangements and oncogenic translocations from whole-genome sequencing in lymphoid neoplasms.	name mentioned^*	literature_supp
33485405	Enhancement versus neutralization by SARS-CoV-2 antibodies from a convalescent donor associates with distinct epitopes on the RBD.	name mentioned^*	literature_supp
33843586	Distinct clonal evolution of B-cells in HIV controllers with neutralizing antibody breadth.	name mentioned^*	literature_supp
34242577	In vitro and in vivo functions of SARS-CoV-2 infection-enhancing and neutralizing antibodies.	name mentioned^*	literature_supp
34765543	The Hydropathy Index of the HCDR3 Region of the B-Cell Receptor Identifies Two Subgroups of IGHV-Mutated Chronic Lymphocytic Leukemia Patients With Distinct Outcome.	name mentioned^*	literature_supp
34788600	Immunizations with diverse sarbecovirus receptor-binding domains elicit SARS-CoV-2 neutralizing antibodies against a conserved site of vulnerability.	name mentioned^*	literature_supp
35837088	Characterizing Features of Human Circulating B Cells Carrying CLL-Like Stereotyped Immunoglobulin Rearrangements.	name mentioned^*	literature_supp
36351924	Single-cell profiling reveals a memory B cell-like subtype of follicular lymphoma with increased transformation risk.	name mentioned^*	literature_supp
36555330	Single-Cell RNA Sequencing for the Detection of Clonotypic V(D)J Rearrangements in Multiple Myeloma.	name mentioned^*	literature_supp
36827454	Modeling and predicting the overlap of B- and T-cell receptor repertoires in healthy and SARS-CoV-2 infected individuals.	name mentioned^*	literature_supp
36874132	Characterization of clonal immunoglobulin heavy V-D-J gene rearrangements in Chinese patients with chronic lymphocytic leukemia: Clinical features and molecular profiles.	name mentioned^*	literature_supp
38435425	Analysis of immunoglobulin/T-cell receptor repertoires by high-throughput RNA sequencing reveals a continuous dynamic of positive clonal selection in follicular lymphoma.	name mentioned^*	literature_supp
39840032	An allelic atlas of immunoglobulin heavy chain variable regions reveals antibody binding epitope preference resilient to SARS-CoV-2 mutation escape.	name mentioned^*	literature_supp
40433552	Antigen selection reflected in the subclonal architecture of the B-cell receptor immunoglobulin gene repertoire in splenic marginal zone lymphoma.	name mentioned^*	literature_supp
40664667	High-resolution mapping of single cells in spatial context.	name mentioned^*	literature_supp
41403245	Explore antibody repertoire in the era of AI.	name mentioned^*	literature_supp
41606257	Allergen-specific human IgE isolated through an allergen-agnostic pipeline-understanding immune response and allergen recognition.	name mentioned^*	literature_supp
41617721	Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity.	name mentioned^*	literature_supp
41803327	IFN-gene signatures in B cells following influenza A and B virus infection and influenza vaccination.	name mentioned^*	literature_supp
42078068	B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGTGAGGGGAAGGCAGTGTGAGCCCAGACACCAGCC	IMGT	COW-ROP2KP

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGGAAACTGCTCCTCATGCTCCAGGGTACAATCCACCCCTGGGTGTCCACTCC	43 + 11 nt	IMGT	COW-LZ4FVG

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/COW-VJ3RF6EAH/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases