FERRET-VMCMGKPOB

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMustela putorius LocusIGH TypeV FunctionalTrue Length296 nt

IGHV3-20*01: a Mustela putorius IGH V allele sequence, 296 nt, functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Mustela putorius (NCBITAXON:9668)
Locus / type	IGH / V
Functional i	True
Length	296 nt
Protein UID i	FERRET-VP-BTXPA5 (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

296 nt

GAGGTGCAGCTGGTGGAGTCTGGGGGTGACCTGGTGAAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTCAGCAACTACTACATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGCAGTGGGTCGCATGGATTAATACTGGTGGAAGTAGCACAAGCTACGCAGACTCTGTGAAGGGCCGATTCACCATCTCCAGAGACAATGGCAAGAACACGCTGTATCTGCAGATGAACAGCCTGAGAGCCGAGGACACGGCCATGTATTACTGTGCGAGAGA

Amino-acid sequence (V-REGION)

98 aa

EVQLVESGGDLVKPGGSLRLSCAASGFTFSNYYMSWVRQAPGKGLQWVAWINTGGSSTSYADSVKGRFTISRDNGKNTLYLQMNSLRAEDTAMYYCAR

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (FERRET-VMCMGKPOB). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV3-20*01	IMGT	IMGT

External records i

IMGT: IGHV3-20*01

Literature references 30 total · 1 sequence-in-paper · 29 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
40116504	Development of ferret immune repertoire reference resources and single-cell-based high-throughput profiling assays.	sequence in paper	literature_supp
28725665	Data on haplotype-supported immunoglobulin germline gene inference.	name mentioned^*	literature_supp
29545810	Repertoire Analysis of Antibody CDR-H3 Loops Suggests Affinity Maturation Does Not Typically Result in Rigidification.	name mentioned^*	literature_supp
29662487	Acquisition of N-Glycosylation Sites in Immunoglobulin Heavy Chain Genes During Local Expansion in Parotid Salivary Glands of Primary Sjögren Patients.	name mentioned^*	literature_supp
30663541	ALTHEA Gold Libraries™: antibody libraries for therapeutic antibody discovery.	name mentioned^*	literature_supp
31839985	More than one antibody of individual B cells revealed by single-cell immune profiling.	name mentioned^*	literature_supp
32425948	AID Overlapping and Polη Hotspots Are Key Features of Evolutionary Variation Within the Human Antibody Heavy Chain (IGHV) Genes.	name mentioned^*	literature_supp
33048842	Antimalarial antibody repertoire defined by plasma IG proteomics and single B cell IG sequencing.	name mentioned^*	literature_supp
33485405	Enhancement versus neutralization by SARS-CoV-2 antibodies from a convalescent donor associates with distinct epitopes on the RBD.	name mentioned^*	literature_supp
34040612	Characterization of DNA G-Quadruplex Structures in Human Immunoglobulin Heavy Variable (IGHV) Genes.	name mentioned^*	literature_supp
34126625	Naturally enhanced neutralizing breadth against SARS-CoV-2 one year after infection.	name mentioned^*	literature_supp
34614412	mRNA vaccination of naive and COVID-19-recovered individuals elicits potent memory B cells that recognize SARS-CoV-2 variants.	name mentioned^*	literature_supp
34614504	Follicular lymphoma subgroups with and without t(14;18) differ in their N-glycosylation pattern and IGHV usage.	name mentioned^*	literature_supp
34765543	The Hydropathy Index of the HCDR3 Region of the B-Cell Receptor Identifies Two Subgroups of IGHV-Mutated Chronic Lymphocytic Leukemia Patients With Distinct Outcome.	name mentioned^*	literature_supp
34785098	Landscapes and dynamic diversifications of B-cell receptor repertoires in COVID-19 patients.	name mentioned^*	literature_supp
35776090	Antibody evolution to SARS-CoV-2 after single-dose Ad26.COV2.S vaccine in humans.	name mentioned^*	literature_supp
35837088	Characterizing Features of Human Circulating B Cells Carrying CLL-Like Stereotyped Immunoglobulin Rearrangements.	name mentioned^*	literature_supp
36006380	Humoral immunity to SARS-CoV-2 elicited by combination COVID-19 vaccination regimens.	name mentioned^*	literature_supp
36149398	Memory B cell responses to Omicron subvariants after SARS-CoV-2 mRNA breakthrough infection in humans.	name mentioned^*	literature_supp
36328595	Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing.	name mentioned^*	literature_supp
36473496	Antibody feedback regulates immune memory after SARS-CoV-2 mRNA vaccination.	name mentioned^*	literature_supp
36827454	Modeling and predicting the overlap of B- and T-cell receptor repertoires in healthy and SARS-CoV-2 infected individuals.	name mentioned^*	literature_supp
37368240	Memory B cell development elicited by mRNA booster vaccinations in the elderly.	name mentioned^*	literature_supp
37533642	TRAPnSeq allows high-throughput profiling of antigen-specific antibody-secreting cells.	name mentioned^*	literature_supp
38961347	Systematic characterization of immunoglobulin loci and deep sequencing of the expressed repertoire in the Atlantic cod (Gadus morhua).	name mentioned^*	literature_supp
39840032	An allelic atlas of immunoglobulin heavy chain variable regions reveals antibody binding epitope preference resilient to SARS-CoV-2 mutation escape.	name mentioned^*	literature_supp
40066131	Characterization of Immunoglobulin Heavy Locus Rearrangements in Molecular Subtypes of Childhood B-Cell Precursor Acute Lymphoblastic Leukemia.	name mentioned^*	literature_supp
41606257	Allergen-specific human IgE isolated through an allergen-agnostic pipeline-understanding immune response and allergen recognition.	name mentioned^*	literature_supp
41617721	Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity.	name mentioned^*	literature_supp
42078068	B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/FERRET-VMCMGKPOB/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases