GORILLA-VHYFUY3QK

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesGorilla gorilla LocusIGH TypeV FunctionalTrue Length296 nt

IGHV3-30-5*01: a Gorilla gorilla IGH V allele sequence, 296 nt, functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Gorilla gorilla (NCBITAXON:9593)
Locus / type	IGH / V
Functional i	True
Length	296 nt
Protein UID i	GORILLA-VP-NWV75K (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

296 nt

CAGGTGCAGCTGGTGGAATCTGTGGGAGGCGTGGTACAGCCTGGGAGGTCCCTGACACTCTCCTGTGCAGCCTCTGGATTCACCTTCAGTAACTATGGCATGCACTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTGGCAGTTATCTGGAATGATGGAAGTAATAAATACTATGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTTCAAATGAACAGCCTGAGAGCTGAGGACACGGCCGTGTATTACTGTGCGAAAGA

Amino-acid sequence (V-REGION)

98 aa

QVQLVESVGGVVQPGRSLTLSCAASGFTFSNYGMHWVRQAPGKGLEWVAVIWNDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (GORILLA-VHYFUY3QK). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV3-30-5*01	IMGT	IMGT

External records i

IMGT: IGHV3-30-5*01

Literature references 20 total · 20 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
29558968	BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data.	name mentioned^*	literature_supp
30697215	VH1-69 Utilizing Antibodies Are Capable of Mediating Non-neutralizing Fc-Mediated Effector Functions Against the Transmitted/Founder gp120.	name mentioned^*	literature_supp
31839985	More than one antibody of individual B cells revealed by single-cell immune profiling.	name mentioned^*	literature_supp
31974198	Genomic arrays identify high-risk chronic lymphocytic leukemia with genomic complexity: a multi-center study.	name mentioned^*	literature_supp
32365177	Polymorphisms in human immunoglobulin heavy chain variable genes and their upstream regions.	name mentioned^*	literature_supp
32636395	IgCaller for reconstructing immunoglobulin gene rearrangements and oncogenic translocations from whole-genome sequencing in lymphoid neoplasms.	name mentioned^*	literature_supp
32668194	Next-Generation Sequencing of T and B Cell Receptor Repertoires from COVID-19 Patients Showed Signatures Associated with Severity of Disease.	name mentioned^*	literature_supp
33969321	Divergent and self-reactive immune responses in the CNS of COVID-19 patients with neurological symptoms.	name mentioned^*	literature_supp
34242577	In vitro and in vivo functions of SARS-CoV-2 infection-enhancing and neutralizing antibodies.	name mentioned^*	literature_supp
34484220	RAPID: A Rep-Seq Dataset Analysis Platform With an Integrated Antibody Database.	name mentioned^*	literature_supp
34764956	Novel Allele Detection Tool Benchmark and Application With Antibody Repertoire Sequencing Dataset.	name mentioned^*	literature_supp
35108220	Ultrapotent neutralizing antibodies against SARS-CoV-2 with a high degree of mutation resistance.	name mentioned^*	literature_supp
35837088	Characterizing Features of Human Circulating B Cells Carrying CLL-Like Stereotyped Immunoglobulin Rearrangements.	name mentioned^*	literature_supp
37533642	TRAPnSeq allows high-throughput profiling of antigen-specific antibody-secreting cells.	name mentioned^*	literature_supp
38406579	AIRR-C IG Reference Sets: curated sets of immunoglobulin heavy and light chain germline genes.	name mentioned^*	literature_supp
38435425	Analysis of immunoglobulin/T-cell receptor repertoires by high-throughput RNA sequencing reveals a continuous dynamic of positive clonal selection in follicular lymphoma.	name mentioned^*	literature_supp
39840032	An allelic atlas of immunoglobulin heavy chain variable regions reveals antibody binding epitope preference resilient to SARS-CoV-2 mutation escape.	name mentioned^*	literature_supp
40588565	Disease-specific U1 spliceosomal RNA mutations in mature B-cell neoplasms.	name mentioned^*	literature_supp
41606257	Allergen-specific human IgE isolated through an allergen-agnostic pipeline-understanding immune response and allergen recognition.	name mentioned^*	literature_supp
42078068	B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/GORILLA-VHYFUY3QK/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases