GORILLA-VL3GQSXXU

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesGorilla gorilla LocusIGH TypeV FunctionalTrue Length299 nt

IGHV4-61*02: a Gorilla gorilla IGH V allele sequence, 299 nt, functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Gorilla gorilla (NCBITAXON:9593)
Locus / type	IGH / V
Functional i	True
Length	299 nt
Protein UID i	GORILLA-VP-NLXMK7 (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

299 nt

CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCACAGACCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGCAGTAGTGATTACTACTGGAGCTGGATCCGGCAGCCCGCCGGGAAGGGACTGGAGTGGATTGGGCGTATCTATACCAGTGGGAGCACCAACTACAACCCCTCCCTCAAGAGTCGAGTCACCATATCAGTAGACACGTCCAAGAACCAGTTCTCCCTGAAGCTGAGCTCTGTGACCGCCTCGGACACGGCCGTGTATTACTGTGCGAGAGA

Amino-acid sequence (V-REGION)

99 aa

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSSDYYWSWIRQPAGKGLEWIGRIYTSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTASDTAVYYCAR

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (GORILLA-VL3GQSXXU). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV4-61*02	IMGT	IMGT

External records i

IMGT: IGHV4-61*02

Literature references 40 total · 1 sequence-in-paper · 39 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
40205052	Complete sequencing of ape genomes.	sequence in paper	literature_supp
22111995	Isolation of a nanomolar scFv inhibiting the endopeptidase activity of botulinum toxin A, by single-round panning of an immune phage-displayed library of macaque origin.	name mentioned^*	literature_supp
23153214	A novel strategy for efficient production of anti-V3 human scFvs against HIV-1 clade C.	name mentioned^*	literature_supp
29558968	BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data.	name mentioned^*	literature_supp
29662487	Acquisition of N-Glycosylation Sites in Immunoglobulin Heavy Chain Genes During Local Expansion in Parotid Salivary Glands of Primary Sjögren Patients.	name mentioned^*	literature_supp
30697215	VH1-69 Utilizing Antibodies Are Capable of Mediating Non-neutralizing Fc-Mediated Effector Functions Against the Transmitted/Founder gp120.	name mentioned^*	literature_supp
32636395	IgCaller for reconstructing immunoglobulin gene rearrangements and oncogenic translocations from whole-genome sequencing in lymphoid neoplasms.	name mentioned^*	literature_supp
33048842	Antimalarial antibody repertoire defined by plasma IG proteomics and single B cell IG sequencing.	name mentioned^*	literature_supp
33106546	Association of an IGHV3-66 gene variant with Kawasaki disease.	name mentioned^*	literature_supp
33661303	Plasmodium falciparum-specific IgM B cells dominate in children, expand with malaria, and produce functional IgM.	name mentioned^*	literature_supp
33843586	Distinct clonal evolution of B-cells in HIV controllers with neutralizing antibody breadth.	name mentioned^*	literature_supp
34126625	Naturally enhanced neutralizing breadth against SARS-CoV-2 one year after infection.	name mentioned^*	literature_supp
34175903	Immunoglobulin germline gene variation and its impact on human disease.	name mentioned^*	literature_supp
34242577	In vitro and in vivo functions of SARS-CoV-2 infection-enhancing and neutralizing antibodies.	name mentioned^*	literature_supp
34484220	RAPID: A Rep-Seq Dataset Analysis Platform With an Integrated Antibody Database.	name mentioned^*	literature_supp
34614412	mRNA vaccination of naive and COVID-19-recovered individuals elicits potent memory B cells that recognize SARS-CoV-2 variants.	name mentioned^*	literature_supp
34764956	Novel Allele Detection Tool Benchmark and Application With Antibody Repertoire Sequencing Dataset.	name mentioned^*	literature_supp
34765543	The Hydropathy Index of the HCDR3 Region of the B-Cell Receptor Identifies Two Subgroups of IGHV-Mutated Chronic Lymphocytic Leukemia Patients With Distinct Outcome.	name mentioned^*	literature_supp
34785098	Landscapes and dynamic diversifications of B-cell receptor repertoires in COVID-19 patients.	name mentioned^*	literature_supp
34788600	Immunizations with diverse sarbecovirus receptor-binding domains elicit SARS-CoV-2 neutralizing antibodies against a conserved site of vulnerability.	name mentioned^*	literature_supp
35447092	Analysis of memory B cells identifies conserved neutralizing epitopes on the N-terminal domain of variant SARS-Cov-2 spike proteins.	name mentioned^*	literature_supp
35776090	Antibody evolution to SARS-CoV-2 after single-dose Ad26.COV2.S vaccine in humans.	name mentioned^*	literature_supp
35837088	Characterizing Features of Human Circulating B Cells Carrying CLL-Like Stereotyped Immunoglobulin Rearrangements.	name mentioned^*	literature_supp
36006380	Humoral immunity to SARS-CoV-2 elicited by combination COVID-19 vaccination regimens.	name mentioned^*	literature_supp
36149398	Memory B cell responses to Omicron subvariants after SARS-CoV-2 mRNA breakthrough infection in humans.	name mentioned^*	literature_supp
36328595	Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing.	name mentioned^*	literature_supp
36798124	Analysis of IGH allele content in a sample group of rheumatoid arthritis patients demonstrates unrevealed population heterogeneity.	name mentioned^*	literature_supp
36827454	Modeling and predicting the overlap of B- and T-cell receptor repertoires in healthy and SARS-CoV-2 infected individuals.	name mentioned^*	literature_supp
36874132	Characterization of clonal immunoglobulin heavy V-D-J gene rearrangements in Chinese patients with chronic lymphocytic leukemia: Clinical features and molecular profiles.	name mentioned^*	literature_supp
37114042	Adaptive immune receptor genotyping using the corecount program.	name mentioned^*	literature_supp
37368240	Memory B cell development elicited by mRNA booster vaccinations in the elderly.	name mentioned^*	literature_supp
37479682	Genetic variation in the immunoglobulin heavy chain locus shapes the human antibody repertoire.	name mentioned^*	literature_supp
38435425	Analysis of immunoglobulin/T-cell receptor repertoires by high-throughput RNA sequencing reveals a continuous dynamic of positive clonal selection in follicular lymphoma.	name mentioned^*	literature_supp
39840032	An allelic atlas of immunoglobulin heavy chain variable regions reveals antibody binding epitope preference resilient to SARS-CoV-2 mutation escape.	name mentioned^*	literature_supp
40066131	Characterization of Immunoglobulin Heavy Locus Rearrangements in Molecular Subtypes of Childhood B-Cell Precursor Acute Lymphoblastic Leukemia.	name mentioned^*	literature_supp
40433552	Antigen selection reflected in the subclonal architecture of the B-cell receptor immunoglobulin gene repertoire in splenic marginal zone lymphoma.	name mentioned^*	literature_supp
41606257	Allergen-specific human IgE isolated through an allergen-agnostic pipeline-understanding immune response and allergen recognition.	name mentioned^*	literature_supp
41607487	Human genetic influences on early B cell development.	name mentioned^*	literature_supp
41617721	Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity.	name mentioned^*	literature_supp
42078068	B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/GORILLA-VL3GQSXXU/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases