AIRBabel immunoglobulin and T-cell receptor allele sequences · leaders · RSSs

← back to search

GORILLA-VLYFYMVSH

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesGorilla gorilla LocusIGH TypeV FunctionalTrue Length296 nt
SpeciesGorilla gorilla (NCBITAXON:9593)
Locus / typeIGH / V
Functional iTrue
Length296 nt
Protein UID iGORILLA-VP-XZ6QOT (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (GORILLA-VLYFYMVSH). None is canonical; they are labels, and the UID is the key.

NameSchemeSource(s)
IGHV1-69*03 IMGT IMGT

External records i

IMGT: IGHV1-69*03

Literature references 10 total · 1 sequence-in-paper · 9 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMIDTitleEvidenceSource
40205052 Complete sequencing of ape genomes. sequence in paper literature_supp
29558968 BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data. name mentioned* literature_supp
32636395 IgCaller for reconstructing immunoglobulin gene rearrangements and oncogenic translocations from whole-genome sequencing in lymphoid neoplasms. name mentioned* literature_supp
34484220 RAPID: A Rep-Seq Dataset Analysis Platform With an Integrated Antibody Database. name mentioned* literature_supp
34671351 Computational Inference, Validation, and Analysis of 5'UTR-Leader Sequences of Alleles of Immunoglobulin Heavy Chain Variable Genes. name mentioned* literature_supp
34764956 Novel Allele Detection Tool Benchmark and Application With Antibody Repertoire Sequencing Dataset. name mentioned* literature_supp
39698082 Comprehensive method for producing high-affinity mouse monoclonal antibodies of various isotypes against (4-hydroxy-3-nitrophenyl)acetyl (NP) hapten. name mentioned* literature_supp
40588565 Disease-specific U1 spliceosomal RNA mutations in mature B-cell neoplasms. name mentioned* literature_supp
41617721 Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity. name mentioned* literature_supp
42078068 B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies. name mentioned* literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/GORILLA-VLYFYMVSH/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

296 nt
CAGGTCCAGCTGGTGCAGTCCGGGGCTGAGGTGAAGAAGCCTGGGTCCTCAGTGAAGGTCTCCTGCAAGCTTTCTGGAGGCACCTTCAGCAGCTATGCTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAGGGTTCATCCCTATCCTTGGTACAGCAAACTACGCACAGAAGTTCCAGGGCAGAGTCACGATTACCGCGGACGAATCCACGAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCGACAGA

Amino-acid sequence (V-REGION)

98 aa
QVQLVQSGAEVKKPGSSVKVSCKLSGGTFSSYAISWVRQAPGQGLEWMGGFIPILGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAT

Published by the source, and consistent with the nucleotide sequence above. i