GORILLA-VM7IEPYRG

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesGorilla gorilla LocusIGH TypeV FunctionalTrue Length296 nt

Species	Gorilla gorilla (NCBITAXON:9593)
Locus / type	IGH / V
Functional i	True
Length	296 nt
Protein UID i	GORILLA-VP-EVAWJH (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (GORILLA-VM7IEPYRG). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV1-2*01	IMGT	IMGT

External records i

IMGT: IGHV1-2*01

Literature references 29 total · 1 sequence-in-paper · 28 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
40205052	Complete sequencing of ape genomes.	sequence in paper	literature_supp
20875155	Clustering-based identification of clonally-related immunoglobulin gene sequence sets.	name mentioned^*	literature_supp
24600447	Immunoglobulin and T Cell Receptor Genes: IMGT(®) and the Birth and Rise of Immunoinformatics.	name mentioned^*	literature_supp
25521638	Immunoglobulins: 25 years of immunoinformatics and IMGT-ONTOLOGY.	name mentioned^*	literature_supp
27074145	Maximum-Entropy Models of Sequenced Immune Repertoires Predict Antigen-Antibody Affinity.	name mentioned^*	literature_supp
29283291	Structural insights into humanization of anti-tissue factor antibody 10H10.	name mentioned^*	literature_supp
29558968	BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data.	name mentioned^*	literature_supp
31839985	More than one antibody of individual B cells revealed by single-cell immune profiling.	name mentioned^*	literature_supp
31873728	Benchmarking immunoinformatic tools for the analysis of antibody repertoire sequences.	name mentioned^*	literature_supp
32636395	IgCaller for reconstructing immunoglobulin gene rearrangements and oncogenic translocations from whole-genome sequencing in lymphoid neoplasms.	name mentioned^*	literature_supp
32878258	Immunoglobulins or Antibodies: IMGT® Bridging Genes, Structures and Functions.	name mentioned^*	literature_supp
33717051	Poorly Expressed Alleles of Several Human Immunoglobulin Heavy Chain Variable Genes are Common in the Human Population.	name mentioned^*	literature_supp
34484220	RAPID: A Rep-Seq Dataset Analysis Platform With an Integrated Antibody Database.	name mentioned^*	literature_supp
34764956	Novel Allele Detection Tool Benchmark and Application With Antibody Repertoire Sequencing Dataset.	name mentioned^*	literature_supp
35545447	Gene prediction in the immunoglobulin loci.	name mentioned^*	literature_supp
35592326	Pandemic, Epidemic, Endemic: B Cell Repertoire Analysis Reveals Unique Anti-Viral Responses to SARS-CoV-2, Ebola and Respiratory Syncytial Virus.	name mentioned^*	literature_supp
36328595	Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing.	name mentioned^*	literature_supp
36604758	Bacteroides-derived isovaleric acid enhances mucosal immunity by facilitating intestinal IgA response in broilers.	name mentioned^*	literature_supp
37640732	Engaging an HIV vaccine target through the acquisition of low B cell affinity.	name mentioned^*	literature_supp
38567069	Diversification of immunoglobulin genes by gene conversion in the domestic chicken (Gallus gallus domesticus).	name mentioned^*	literature_supp
38961347	Systematic characterization of immunoglobulin loci and deep sequencing of the expressed repertoire in the Atlantic cod (Gadus morhua).	name mentioned^*	literature_supp
39840032	An allelic atlas of immunoglobulin heavy chain variable regions reveals antibody binding epitope preference resilient to SARS-CoV-2 mutation escape.	name mentioned^*	literature_supp
40066131	Characterization of Immunoglobulin Heavy Locus Rearrangements in Molecular Subtypes of Childhood B-Cell Precursor Acute Lymphoblastic Leukemia.	name mentioned^*	literature_supp
40664667	High-resolution mapping of single cells in spatial context.	name mentioned^*	literature_supp
41021799	Molecular divergence and convergence of mammalian antibody responses to the influenza virus hemagglutinin stem.	name mentioned^*	literature_supp
41617721	Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity.	name mentioned^*	literature_supp
41941497	Pigs lacking Natural Killer T cells have altered cellular responses to influenza.	name mentioned^*	literature_supp
42041394	IMGT® Nomenclature of Immunoglobulins (IG) or Antibodies and T Cell Receptors (TR): A Common Language for Immunoinformatics and Artificial Intelligence (AI).	name mentioned^*	literature_supp
42078068	B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/GORILLA-VM7IEPYRG/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

296 nt

CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCGTCTGGATACACCTTCACCGGCTACTATATGCACTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAACCCTAACAGTGGTGGCACAAACTACGCACAGAAGTTTCAGGGCAGGGTCACCATGACCAGGGACACGTCCATCAGCACAGCCTACATGGAGCTGAGCAGGCTGAGATCTGAGGACACGGCCACGTATTACTGTACGAGAGA

Amino-acid sequence (V-REGION)

98 aa

QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSEDTATYYCTR

Published by the source, and consistent with the nucleotide sequence above. i

API: JSON · AIRR AlleleDescription · aliases