AIRBabel immunoglobulin and T-cell receptor allele sequences · leaders · RSSs

← back to search

GORILLA-VVIQTAO6R

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesGorilla gorilla LocusIGH TypeV FunctionalNone Length296 nt
SpeciesGorilla gorilla (NCBITAXON:9593)
Locus / typeIGH / V
Functional iNone
Length296 nt
Protein UID iGORILLA-VP-MWVWXK (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (GORILLA-VVIQTAO6R). None is canonical; they are labels, and the UID is the key.

NameSchemeSource(s)
IGHV1-12*01 IMGT IMGT

External records i

IMGT: IGHV1-12*01

Literature references 13 total · 13 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMIDTitleEvidenceSource
29545810 Repertoire Analysis of Antibody CDR-H3 Loops Suggests Affinity Maturation Does Not Typically Result in Rigidification. name mentioned* literature_supp
34764956 Novel Allele Detection Tool Benchmark and Application With Antibody Repertoire Sequencing Dataset. name mentioned* literature_supp
34813501 B cell receptor isotypes differentially associate with cell signaling, kinetics, and outcome in chronic lymphocytic leukemia. name mentioned* literature_supp
36328595 Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing. name mentioned* literature_supp
36473496 Antibody feedback regulates immune memory after SARS-CoV-2 mRNA vaccination. name mentioned* literature_supp
36604758 Bacteroides-derived isovaleric acid enhances mucosal immunity by facilitating intestinal IgA response in broilers. name mentioned* literature_supp
37533642 TRAPnSeq allows high-throughput profiling of antigen-specific antibody-secreting cells. name mentioned* literature_supp
37938344 Role of affinity in plasma cell development in the germinal center light zone. name mentioned* literature_supp
39698082 Comprehensive method for producing high-affinity mouse monoclonal antibodies of various isotypes against (4-hydroxy-3-nitrophenyl)acetyl (NP) hapten. name mentioned* literature_supp
41021799 Molecular divergence and convergence of mammalian antibody responses to the influenza virus hemagglutinin stem. name mentioned* literature_supp
41410768 Convergent mutation trajectories convert functional self-tolerance in IGHV4-34 B cells to genetic tolerance encoded in the antibody. name mentioned* literature_supp
41873331 Porcine influenza mAbs to H3, H5, and H7 hemagglutinins recognize H3 egg adapted site and target the HA stem. name mentioned* literature_supp
41941497 Pigs lacking Natural Killer T cells have altered cellular responses to influenza. name mentioned* literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/GORILLA-VVIQTAO6R/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

296 nt
CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCCGGATACACCTTCACCTACTGCTACTTGCACTGGGTGCAACAGGTCCCTGGACAAGGGCTCGAGTGGACAGGATTTTAGTTATTTGAGAGATTTTTCATACAACATTTATTCTGTAAGCAAATTTCAGGGATTGTAGAATGAATCATATTAACAAATCTGACACAGAACTTCCTCTGAATCAATCTTTGTAAACATCAGTTTCTGAATCAATGTTGTAAATA

Amino-acid sequence (V-REGION)

98 aa
QVQLVQSGAEVKKPGASVKVSCKASGYTFTYCYLHWVQQVPGQGLEWTGF*LFERFFIQHLFCKQISGIVE*IILTNLTQNFL*INLCKHQFLNQCCK

Translated here from the nucleotide sequence; no source published a protein for this allele. i