GORILLA-VWDF2F76T

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesGorilla gorilla LocusTRB TypeV FunctionalNone Length290 nt

TRBV7-6*01: a Gorilla gorilla TRB V allele sequence, 290 nt, not recorded. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Gorilla gorilla (NCBITAXON:9593)
Locus / type	TRB / V
Functional i	None
Length	290 nt
Protein UID i	GORILLA-VP-TI3XAB (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

290 nt

GGTGCTGGAGTCTCCCAGGCTCCCAGGTTCAAAGTCACAAAGAGGGGACAGGATGTAGCTCTCAGGTGTGATCCAATTTCGGGTCATGTAGCCCTTTATTGGTACCGACAGGCCCTGGGGCAGGGCCCAGAGTTTCTGACTTACTTCAATGATGAAGCTCAACCAGACAAATCAGGAATGCCCAATGATCGGTTCTCTGCAGAGAGGCCTGAGGGATCCATCTCCACTCTGACGATCCAGCGCACAGAGCAGCGGGACTCGGCCATGTATCTCTGTGCCAGCAGCTTAGC

Amino-acid sequence (V-REGION)

96 aa

GAGVSQAPRFKVTKRGQDVALRCDPISGHVALYWYRQALGQGPEFLTYFNDEAQPDKSGMPNDRFSAERPEGSISTLTIQRTEQRDSAMYLCASSL

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (GORILLA-VWDF2F76T). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
TRBV7-6*01	IMGT	IMGT

External records i

IMGT: TRBV7-6*01

Literature references 19 total · 19 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
22792299	Unbiased analysis of TCRα/β chains at the single-cell level in human CD8+ T-cell subsets.	name mentioned^*	literature_supp
26962778	High Throughput Sequencing of T Cell Antigen Receptors Reveals a Conserved TCR Repertoire.	name mentioned^*	literature_supp
30152754	Human T cell receptor occurrence patterns encode immune history, genetic background, and receptor specificity.	name mentioned^*	literature_supp
31237075	Comparative analysis of CDR3 regions in paired human αβ CD8 T cells.	name mentioned^*	literature_supp
34845983	TCR meta-clonotypes for biomarker discovery with tcrdist3 enabled identification of public, HLA-restricted clusters of SARS-CoV-2 TCRs.	name mentioned^*	literature_supp
35436998	pmTR database: population matched (pm) germline allelic variants of T-cell receptor (TR) loci.	name mentioned^*	literature_supp
36408799	SARS-CoV-2-specific CD4+ and CD8+ T cell responses can originate from cross-reactive CMV-specific T cells.	name mentioned^*	literature_supp
36778049	Targeted long-read sequencing facilitates phased diploid assembly and genotyping of the human T cell receptor alpha, delta, and beta loci.	name mentioned^*	literature_supp
38304555	SARS-CoV-2-associated T-cell infiltration in the central nervous system.	name mentioned^*	literature_supp
38871688	Germline-like TCR-α chains shared between autoreactive T cells in blood and pancreas.	name mentioned^*	literature_supp
38878776	Quantifiable TCR repertoire changes in prediagnostic blood specimens among patients with high-grade ovarian cancer.	name mentioned^*	literature_supp
39421738	scRNA+TCR-seq reveals the pivotal role of dual receptor T lymphocytes in the pathogenesis of Kawasaki disease and during IVIG treatment.	name mentioned^*	literature_supp
39472557	Physiological and pathogenic T cell autoreactivity converge in type 1 diabetes.	name mentioned^*	literature_supp
40165973	T-cell receptors identified by a personalized antigen-agnostic screening approach target shared neoantigen KRAS Q61H.	name mentioned^*	literature_supp
40664667	High-resolution mapping of single cells in spatial context.	name mentioned^*	literature_supp
40877317	Molecular basis of potent antiviral HLA-C-restricted CD8+ T cell response to an immunodominant SARS-CoV-2 nucleocapsid epitope.	name mentioned^*	literature_supp
41150899	Large-Scale T-cell Receptor Repertoire Profiling Unveils Tumor-Specific Signals for Diagnosing Indeterminate Pulmonary Nodules.	name mentioned^*	literature_supp
41424382	Identification of Sjögren's disease-associated T cell receptor motifs through deep sequencing.	name mentioned^*	literature_supp
42125653	N-terminal pyroglutamylation of an HLA-A24-restricted immunodominant epitope enhances SARS-CoV-2-specific T-cell responses.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/GORILLA-VWDF2F76T/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases