GORILLA-VWPKDIKAG

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesGorilla gorilla LocusIGH TypeV FunctionalNone Length295 nt

IGHV7-4-1*02: a Gorilla gorilla IGH V allele sequence, 295 nt, not recorded. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Gorilla gorilla (NCBITAXON:9593)
Locus / type	IGH / V
Functional i	None
Length	295 nt
Protein UID i	GORILLA-VP-2DU2EB (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

295 nt

CAGGTGCAGCTGGTGCAATCTGGGTCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGATACACCTTCACTAGCTATGGTATGAATTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAACACCTACACTGGGAACCCAACATACGCCCAGGGCTTCACAGGACGGTTTGTCTTCTCCATGGACACCTCTGTCAGCACAGCATACCTGCAGATCAGCAGCCTAAAGGCTGAGGATACGGCCATGTATTACTGTGCGAGAGG

Amino-acid sequence (V-REGION)

98 aa

QVQLVQSGSEVKKPGASVKVSCKASDTPSLAMV*IGCDRPLDKGLSGWDGSTPTLGTQHTPRASQDGLSSPWTPLSAQHTCRSAA*RLRIRPCITVRE

Translated here from the nucleotide sequence; no source published a protein for this allele. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (GORILLA-VWPKDIKAG). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV7-4-1*02	IMGT	IMGT

External records i

IMGT: IGHV7-4-1*02

Literature references 39 total · 39 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
22806814	Degenerate primer design to clone the human repertoire of immunoglobulin heavy chain variable regions.	name mentioned^*	literature_supp
25330199	Characteristics of memory B cells elicited by a highly efficacious HPV vaccine in subjects with no pre-existing immunity.	name mentioned^*	literature_supp
29545810	Repertoire Analysis of Antibody CDR-H3 Loops Suggests Affinity Maturation Does Not Typically Result in Rigidification.	name mentioned^*	literature_supp
29892656	Data on the nucleotide composition of the first codons encoding the complementary determining region 3 (CDR3) in immunoglobulin heavy chains.	name mentioned^*	literature_supp
30697215	VH1-69 Utilizing Antibodies Are Capable of Mediating Non-neutralizing Fc-Mediated Effector Functions Against the Transmitted/Founder gp120.	name mentioned^*	literature_supp
31839985	More than one antibody of individual B cells revealed by single-cell immune profiling.	name mentioned^*	literature_supp
32636395	IgCaller for reconstructing immunoglobulin gene rearrangements and oncogenic translocations from whole-genome sequencing in lymphoid neoplasms.	name mentioned^*	literature_supp
33048842	Antimalarial antibody repertoire defined by plasma IG proteomics and single B cell IG sequencing.	name mentioned^*	literature_supp
33485405	Enhancement versus neutralization by SARS-CoV-2 antibodies from a convalescent donor associates with distinct epitopes on the RBD.	name mentioned^*	literature_supp
33717051	Poorly Expressed Alleles of Several Human Immunoglobulin Heavy Chain Variable Genes are Common in the Human Population.	name mentioned^*	literature_supp
33843586	Distinct clonal evolution of B-cells in HIV controllers with neutralizing antibody breadth.	name mentioned^*	literature_supp
34126625	Naturally enhanced neutralizing breadth against SARS-CoV-2 one year after infection.	name mentioned^*	literature_supp
34242577	In vitro and in vivo functions of SARS-CoV-2 infection-enhancing and neutralizing antibodies.	name mentioned^*	literature_supp
34484220	RAPID: A Rep-Seq Dataset Analysis Platform With an Integrated Antibody Database.	name mentioned^*	literature_supp
34614412	mRNA vaccination of naive and COVID-19-recovered individuals elicits potent memory B cells that recognize SARS-CoV-2 variants.	name mentioned^*	literature_supp
34671351	Computational Inference, Validation, and Analysis of 5'UTR-Leader Sequences of Alleles of Immunoglobulin Heavy Chain Variable Genes.	name mentioned^*	literature_supp
34764956	Novel Allele Detection Tool Benchmark and Application With Antibody Repertoire Sequencing Dataset.	name mentioned^*	literature_supp
34765543	The Hydropathy Index of the HCDR3 Region of the B-Cell Receptor Identifies Two Subgroups of IGHV-Mutated Chronic Lymphocytic Leukemia Patients With Distinct Outcome.	name mentioned^*	literature_supp
34785098	Landscapes and dynamic diversifications of B-cell receptor repertoires in COVID-19 patients.	name mentioned^*	literature_supp
35108220	Ultrapotent neutralizing antibodies against SARS-CoV-2 with a high degree of mutation resistance.	name mentioned^*	literature_supp
35205028	Next-Generation Sequencing Revealed a Distinct Immunoglobulin Repertoire with Specific Mutation Hotspots in Acute Myeloid Leukemia.	name mentioned^*	literature_supp
35447092	Analysis of memory B cells identifies conserved neutralizing epitopes on the N-terminal domain of variant SARS-Cov-2 spike proteins.	name mentioned^*	literature_supp
35776090	Antibody evolution to SARS-CoV-2 after single-dose Ad26.COV2.S vaccine in humans.	name mentioned^*	literature_supp
35837088	Characterizing Features of Human Circulating B Cells Carrying CLL-Like Stereotyped Immunoglobulin Rearrangements.	name mentioned^*	literature_supp
36006380	Humoral immunity to SARS-CoV-2 elicited by combination COVID-19 vaccination regimens.	name mentioned^*	literature_supp
36328595	Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing.	name mentioned^*	literature_supp
36473496	Antibody feedback regulates immune memory after SARS-CoV-2 mRNA vaccination.	name mentioned^*	literature_supp
36591518	Evidence of somatic hypermutation in the antigen binding sites of patients with CLL harboring IGHV genes with 100% germline identity.	name mentioned^*	literature_supp
36827454	Modeling and predicting the overlap of B- and T-cell receptor repertoires in healthy and SARS-CoV-2 infected individuals.	name mentioned^*	literature_supp
37114042	Adaptive immune receptor genotyping using the corecount program.	name mentioned^*	literature_supp
37368240	Memory B cell development elicited by mRNA booster vaccinations in the elderly.	name mentioned^*	literature_supp
38435425	Analysis of immunoglobulin/T-cell receptor repertoires by high-throughput RNA sequencing reveals a continuous dynamic of positive clonal selection in follicular lymphoma.	name mentioned^*	literature_supp
39572535	A potent broad-spectrum neutralizing antibody targeting a conserved region of the prefusion RSV F protein.	name mentioned^*	literature_supp
39840032	An allelic atlas of immunoglobulin heavy chain variable regions reveals antibody binding epitope preference resilient to SARS-CoV-2 mutation escape.	name mentioned^*	literature_supp
40066131	Characterization of Immunoglobulin Heavy Locus Rearrangements in Molecular Subtypes of Childhood B-Cell Precursor Acute Lymphoblastic Leukemia.	name mentioned^*	literature_supp
40118521	De novo antibody identification in human blood from full-length single B cell transcriptomics and matching haplotype-resolved germline assemblies.	name mentioned^*	literature_supp
40664667	High-resolution mapping of single cells in spatial context.	name mentioned^*	literature_supp
41617721	Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity.	name mentioned^*	literature_supp
42078068	B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/GORILLA-VWPKDIKAG/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases