GORILLA-VYVKX73HG

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesGorilla gorilla LocusTRA TypeV FunctionalTrue Length277 nt

TRAV12-2*01: a Gorilla gorilla TRA V allele sequence, 277 nt, functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Gorilla gorilla (NCBITAXON:9593)
Locus / type	TRA / V
Functional i	True
Length	277 nt
Protein UID i	GORILLA-VP-67CR7L (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

277 nt

CAGAAGGAGGTGGAGCAGAATTCTGGACCCCTCAGTGTTCCAGAAGGAGCCATTGCCTCTCTCAACTGCACTTACAGTGACCGACGTTCCCAGTCCTTCTTCTGGTACAGACAATATTCTGGGAAAAGCCCTGAGTTGATAATGTCCATATACTCCAATGGTGACAAAGAAGATGGAAGGTTTACAGCACAGCTCAATAAAGCCAGCCAGTATGTTTCTCTGCTCATCAGAGACTCCCAGCCCAGTGATTCAGCCACCTACCTCTGTGCGGTGAACA

Amino-acid sequence (V-REGION)

92 aa

QKEVEQNSGPLSVPEGAIASLNCTYSDRRSQSFFWYRQYSGKSPELIMSIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVN

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (GORILLA-VYVKX73HG). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
TRAV12-2*01	IMGT	IMGT

External records i

IMGT: TRAV12-2*01

Literature references 29 total · 1 sequence-in-paper · 28 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
40205052	Complete sequencing of ape genomes.	sequence in paper	literature_supp
22792299	Unbiased analysis of TCRα/β chains at the single-cell level in human CD8+ T-cell subsets.	name mentioned^*	literature_supp
24897427	CD8+ TCR transgenic strains expressing public versus private TCR targeting the respiratory syncytial virus K(d)M2(82-90) epitope demonstrate similar functional profiles.	name mentioned^*	literature_supp
27460926	Single-cell TCRseq: paired recovery of entire T-cell alpha and beta chain transcripts in T-cell receptors from single-cell RNAseq.	name mentioned^*	literature_supp
30152754	Human T cell receptor occurrence patterns encode immune history, genetic background, and receptor specificity.	name mentioned^*	literature_supp
31237075	Comparative analysis of CDR3 regions in paired human αβ CD8 T cells.	name mentioned^*	literature_supp
32868763	Single-cell RNA sequencing identifies shared differentiation paths of mouse thymic innate T cells.	name mentioned^*	literature_supp
34685626	Molecular Basis of a Dominant SARS-CoV-2 Spike-Derived Epitope Presented by HLA-A*02:01 Recognised by a Public TCR.	name mentioned^*	literature_supp
35436998	pmTR database: population matched (pm) germline allelic variants of T-cell receptor (TR) loci.	name mentioned^*	literature_supp
36408799	SARS-CoV-2-specific CD4+ and CD8+ T cell responses can originate from cross-reactive CMV-specific T cells.	name mentioned^*	literature_supp
36603583	Improved predictions of antigen presentation and TCR recognition with MixMHCpred2.2 and PRIME2.0 reveal potent SARS-CoV-2 CD8+ T-cell epitopes.	name mentioned^*	literature_supp
36778049	Targeted long-read sequencing facilitates phased diploid assembly and genotyping of the human T cell receptor alpha, delta, and beta loci.	name mentioned^*	literature_supp
36923729	Cross-reactivity influences changes in human influenza A virus and Epstein Barr virus specific CD8 memory T cell receptor alpha and beta repertoires between young and old.	name mentioned^*	literature_supp
37248417	Robust and prototypical immune responses toward COVID-19 vaccine in First Nations peoples are impacted by comorbidities.	name mentioned^*	literature_supp
37287989	Targeting KRASG12V mutations with HLA class II-restricted TCR for the immunotherapy in solid tumors.	name mentioned^*	literature_supp
38762584	Invariant γδTCR natural killer-like effector T cells in the naked mole-rat.	name mentioned^*	literature_supp
38871688	Germline-like TCR-α chains shared between autoreactive T cells in blood and pancreas.	name mentioned^*	literature_supp
39133650	Expansion of the HSV-2-specific T cell repertoire in skin after immunotherapeutic HSV-2 vaccine.	name mentioned^*	literature_supp
39421738	scRNA+TCR-seq reveals the pivotal role of dual receptor T lymphocytes in the pathogenesis of Kawasaki disease and during IVIG treatment.	name mentioned^*	literature_supp
39507623	Development and characterization of human T-cell receptor (TCR) alpha and beta clones' library as biological standards and resources for TCR sequencing and engineering.	name mentioned^*	literature_supp
40165973	T-cell receptors identified by a personalized antigen-agnostic screening approach target shared neoantigen KRAS Q61H.	name mentioned^*	literature_supp
40664667	High-resolution mapping of single cells in spatial context.	name mentioned^*	literature_supp
40775219	Integrative multi-omics reveals a regulatory and exhausted T-cell landscape in CLL and identifies galectin-9 as an immunotherapy target.	name mentioned^*	literature_supp
40866291	Spatial TCR clonality and clonal expansion in the in situ microenvironment of non-small cell lung cancer.	name mentioned^*	literature_supp
41306962	Promiscuous class II-binding SARS-CoV-2-nuc derived vaccine-peptide induced extensive conventional, innate and unconventional T cell responses.	name mentioned^*	literature_supp
41407706	Resistance potential of the HLA-A2-restricted immunodominant SARS-CoV-2-specific CD8+ T cell receptor repertoire to antigenic drift.	name mentioned^*	literature_supp
41766885	Correction: Promiscuous class II-binding SARS-CoV-2-nuc derived vaccine-peptide induced extensive conventional, innate and unconventional T cell responses.	name mentioned^*	literature_supp
42125653	N-terminal pyroglutamylation of an HLA-A24-restricted immunodominant epitope enhances SARS-CoV-2-specific T-cell responses.	name mentioned^*	literature_supp
42129543	One-step generation of T-cell receptor knock-in mice in the TCRβ locus.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/GORILLA-VYVKX73HG/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases