HORSE-VUQ5RBFTE

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesEquus caballus LocusIGH TypeV FunctionalNone Length309 nt

IGHV4-28*01: a Equus caballus IGH V allele sequence, 309 nt, not recorded. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Equus caballus (NCBITAXON:9796)
Locus / type	IGH / V
Functional i	None
Length	309 nt
Protein UID i	HORSE-VP-K7Y2EA (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

309 nt

CAGGTGCAGCTGCAGGAGGTGGGCCCAGGACTGGTGAAGCCTCACACACCCTCTGCCTCATCTCTGCTCTCTCTGGATTCTCCATCACAACCAGTGGTTACTTCTGCAGCTGGATCCACCATCCCCAAGGGGAAAAGCCACAGTGGATGGAACACATCTGTTCTGAAGGGAACACTTGCTACAGCCCATCCTTCAACAGCCACACCTCCATCTCCAGAGACACGTCGGGGGACCAGTGGTTCCTGAAGCTTAGCTCCCTGCCTGCTGAGAACATGGCCTATGGGTCTATGGAGATGGCTGTGCAATACA

Amino-acid sequence (V-REGION)

102 aa

GAAAGGGPRTGEASHTLCLISALSGFSITTSGYFCSWIHHPQGEKPQWMEHICSEGNTCYSPSFNSHTSISRDTSGDQWFLKLSSLPAENMAYGSMEMAVQY

Translated here from the nucleotide sequence; no source published a protein for this allele. i

Name history i: formerly IGHV4-30*01 (to 2020-01-31);

Allele names i

Every name below denotes this exact sequence (HORSE-VUQ5RBFTE). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV4-28*01	IMGT	IMGT

Former IMGT names i

Former name	Last seen in IMGT release
*IGHV4-3001**	2020-01-31

External records i

IMGT: IGHV4-28*01

Literature references 15 total · 15 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
19563687	Isolation of a human-like antibody fragment (scFv) that neutralizes ricin biological activity.	name mentioned^*	literature_supp
22111995	Isolation of a nanomolar scFv inhibiting the endopeptidase activity of botulinum toxin A, by single-round panning of an immune phage-displayed library of macaque origin.	name mentioned^*	literature_supp
26440796	Development of Human-Like scFv-Fc Neutralizing Botulinum Neurotoxin E.	name mentioned^*	literature_supp
29558968	BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data.	name mentioned^*	literature_supp
31839985	More than one antibody of individual B cells revealed by single-cell immune profiling.	name mentioned^*	literature_supp
32365177	Polymorphisms in human immunoglobulin heavy chain variable genes and their upstream regions.	name mentioned^*	literature_supp
34040612	Characterization of DNA G-Quadruplex Structures in Human Immunoglobulin Heavy Variable (IGHV) Genes.	name mentioned^*	literature_supp
34614412	mRNA vaccination of naive and COVID-19-recovered individuals elicits potent memory B cells that recognize SARS-CoV-2 variants.	name mentioned^*	literature_supp
35447092	Analysis of memory B cells identifies conserved neutralizing epitopes on the N-terminal domain of variant SARS-Cov-2 spike proteins.	name mentioned^*	literature_supp
36328595	Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing.	name mentioned^*	literature_supp
38435425	Analysis of immunoglobulin/T-cell receptor repertoires by high-throughput RNA sequencing reveals a continuous dynamic of positive clonal selection in follicular lymphoma.	name mentioned^*	literature_supp
39840032	An allelic atlas of immunoglobulin heavy chain variable regions reveals antibody binding epitope preference resilient to SARS-CoV-2 mutation escape.	name mentioned^*	literature_supp
40664667	High-resolution mapping of single cells in spatial context.	name mentioned^*	literature_supp
41617721	Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity.	name mentioned^*	literature_supp
42078068	B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGTGAATGGAAGTCAGCATAAGCCCAGAAACAAACC	IMGT	HORSE-RHN7BU

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGAGACTGTTGAGTCTTCTCCTCTGTCTGGTGATGGCTCCCAAAGGTGTCCTGCCC	46 + 11 nt	IMGT	HORSE-LU5BEW

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/HORSE-VUQ5RBFTE/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases