HUMAN-V3LU6ZLYM

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesHomo sapiens LocusTRA TypeV FunctionalTrue Length280 nt

TRAV13-1*02: a Homo sapiens TRA V allele sequence, 280 nt, functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Earlier records of this allele i

IMGT has published this allele name over more than one sequence extent. Earlier sequence extents are deferred from default search results but remain resolvable, so a paper that cited one still leads here.

Record	Name	Length	Relation to this record	IMGT releases
HUMAN-VCYZS4V6Y	*TRAV13-102**	288 nt	contains this record	2013-01-20

Species	Homo sapiens (NCBITAXON:9606)
Locus / type	TRA / V
Functional i	True
Length	280 nt
Protein UID i	HUMAN-VP-NQJRT7 (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

280 nt

GGAGAGAATGTGGAGCAGCATCCTTCAACCCTGAGTGTCCAGGAGGGAGACAGCGCTGTTATCAAGTGTACTTATTCAGACAGTGCCTCAAACTACTTCCCTTGGTATAAGCAAGAACTTGGAAAAAGACCTCAGCTTATTATAGACATTCGTTCAAATGTGGGCGAAAAGAAAGACCAACGAATTGCTGTTACATTGAACAAGACAGCCAAACATTTCTCCCTGCACATCACAGAGACCCAACCTGAAGACTCGGCTGTCTACTTCTGTGCAGCAAGTA

Amino-acid sequence (V-REGION)

93 aa

GENVEQHPSTLSVQEGDSAVIKCTYSDSASNYFPWYKQELGKRPQLIIDIRSNVGEKKDQRIAVTLNKTAKHFSLHITETQPEDSAVYFCAAS

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: re-cut from TRAV13-1*02 (288 nt);

Allele names i

Every name below denotes this exact sequence (HUMAN-V3LU6ZLYM). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
TRAV13-1*02	IMGT	IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

Name	Kind	Source(s)
MZ339450.1	NCBI accession	ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:MZ339450.1 IMGT: TRAV13-1*02

Literature references 13 total · 1 sequence-in-paper · 12 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
36159868	Profiling genes encoding the adaptive immune receptor repertoire with gAIRR Suite.	sequence in paper	literature_supp
22792299	Unbiased analysis of TCRα/β chains at the single-cell level in human CD8+ T-cell subsets.	name mentioned^*	literature_supp
31237075	Comparative analysis of CDR3 regions in paired human αβ CD8 T cells.	name mentioned^*	literature_supp
35436998	pmTR database: population matched (pm) germline allelic variants of T-cell receptor (TR) loci.	name mentioned^*	literature_supp
36923729	Cross-reactivity influences changes in human influenza A virus and Epstein Barr virus specific CD8 memory T cell receptor alpha and beta repertoires between young and old.	name mentioned^*	literature_supp
38615042	Deep learning predictions of TCR-epitope interactions reveal epitope-specific chains in dual alpha T cells.	name mentioned^*	literature_supp
38871688	Germline-like TCR-α chains shared between autoreactive T cells in blood and pancreas.	name mentioned^*	literature_supp
39507623	Development and characterization of human T-cell receptor (TCR) alpha and beta clones' library as biological standards and resources for TCR sequencing and engineering.	name mentioned^*	literature_supp
40877317	Molecular basis of potent antiviral HLA-C-restricted CD8+ T cell response to an immunodominant SARS-CoV-2 nucleocapsid epitope.	name mentioned^*	literature_supp
41306962	Promiscuous class II-binding SARS-CoV-2-nuc derived vaccine-peptide induced extensive conventional, innate and unconventional T cell responses.	name mentioned^*	literature_supp
41424382	Identification of Sjögren's disease-associated T cell receptor motifs through deep sequencing.	name mentioned^*	literature_supp
41766885	Correction: Promiscuous class II-binding SARS-CoV-2-nuc derived vaccine-peptide induced extensive conventional, innate and unconventional T cell responses.	name mentioned^*	literature_supp
42125653	N-terminal pyroglutamylation of an HLA-A24-restricted immunodominant epitope enhances SARS-CoV-2-specific T-cell responses.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACATTGCTTCCCAGGCACCTGCTACCCGTACACAAACC	IMGT	HUMAN-RWR7U4

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGACATCCATTCGAGCTGTATTTATATTCCTGTGGCTGCAGCTGGACTTGGTGAAT	49 + 8 nt	IMGT	HUMAN-LH52TV

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/HUMAN-V3LU6ZLYM/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases