AIRBabel immunoglobulin and T-cell receptor allele sequences · leaders · RSSs

← back to search

HUMAN-VB2FX4HMM

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesHomo sapiens LocusIGH TypeV FunctionalTrue Length296 nt
SpeciesHomo sapiens (NCBITAXON:9606)
Locus / typeIGH / V
Functional iTrue
Length296 nt
Protein UID iHUMAN-VP-6ZXJ47 (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (HUMAN-VB2FX4HMM). None is canonical; they are labels, and the UID is the key.

NameSchemeSource(s)
IGHV1-IOYO*02 IgLabel HUSA
IGHV1-46*01 IMGT IMGT, KIARVA, OGRDB

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

NameKindSource(s)
X92343.1 NCBI accession ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:X92343 GenBank: GENBANK:X92343.1 IMGT: IGHV1-46*01 OGRDB: IGHV1-46*01

Literature references 64 total · 1 verified · 6 sequence-in-paper · 57 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMIDTitleEvidenceSource
3396540 verified ncbi_nucleotide
24795717 Reconstructing a B-Cell Clonal Lineage. II. Mutation, Selection, and Affinity Maturation. sequence in paper literature_supp
34764956 Novel Allele Detection Tool Benchmark and Application With Antibody Repertoire Sequencing Dataset. sequence in paper literature_supp
36353774 High activation levels maintained in receptor-binding domain-specific memory B cells in people with severe coronavirus disease 2019. sequence in paper literature_supp
37076511 Vaccination of SARS-CoV-2-infected individuals expands a broad range of clonally diverse affinity-matured B cell lineages. sequence in paper literature_supp
37114042 Adaptive immune receptor genotyping using the corecount program. sequence in paper literature_supp
38643233 An ancestral SARS-CoV-2 vaccine induces anti-Omicron variants antibodies by hypermutation. sequence in paper literature_supp
22216179 Biased use of the IGHV4 family and evidence for antigen selection in Chlamydophila psittaci-negative ocular adnexal extranodal marginal zone lymphomas. name mentioned* literature_supp
25330199 Characteristics of memory B cells elicited by a highly efficacious HPV vaccine in subjects with no pre-existing immunity. name mentioned* literature_supp
27423190 A Single Human Papillomavirus Vaccine Dose Improves B Cell Memory in Previously Infected Subjects. name mentioned* literature_supp
28598281 Design, development and characterization of ACT017, a humanized Fab that blocks platelet's glycoprotein VI function without causing bleeding risks. name mentioned* literature_supp
29545810 Repertoire Analysis of Antibody CDR-H3 Loops Suggests Affinity Maturation Does Not Typically Result in Rigidification. name mentioned* literature_supp
29558968 BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data. name mentioned* literature_supp
30697215 VH1-69 Utilizing Antibodies Are Capable of Mediating Non-neutralizing Fc-Mediated Effector Functions Against the Transmitted/Founder gp120. name mentioned* literature_supp
31839985 More than one antibody of individual B cells revealed by single-cell immune profiling. name mentioned* literature_supp
31974198 Genomic arrays identify high-risk chronic lymphocytic leukemia with genomic complexity: a multi-center study. name mentioned* literature_supp
32156260 Tracing CLL-biased stereotyped immunoglobulin gene rearrangements in normal B cell subsets using a high-throughput immunogenetic approach. name mentioned* literature_supp
32316084 Loxoscelism: Advances and Challenges in the Design of Antibody Fragments with Therapeutic Potential. name mentioned* literature_supp
32425948 AID Overlapping and Polη Hotspots Are Key Features of Evolutionary Variation Within the Human Antibody Heavy Chain (IGHV) Genes. name mentioned* literature_supp
32636395 IgCaller for reconstructing immunoglobulin gene rearrangements and oncogenic translocations from whole-genome sequencing in lymphoid neoplasms. name mentioned* literature_supp
33485405 Enhancement versus neutralization by SARS-CoV-2 antibodies from a convalescent donor associates with distinct epitopes on the RBD. name mentioned* literature_supp
33843586 Distinct clonal evolution of B-cells in HIV controllers with neutralizing antibody breadth. name mentioned* literature_supp
34040612 Characterization of DNA G-Quadruplex Structures in Human Immunoglobulin Heavy Variable (IGHV) Genes. name mentioned* literature_supp
34126625 Naturally enhanced neutralizing breadth against SARS-CoV-2 one year after infection. name mentioned* literature_supp
34242577 In vitro and in vivo functions of SARS-CoV-2 infection-enhancing and neutralizing antibodies. name mentioned* literature_supp
34484220 RAPID: A Rep-Seq Dataset Analysis Platform With an Integrated Antibody Database. name mentioned* literature_supp
34614412 mRNA vaccination of naive and COVID-19-recovered individuals elicits potent memory B cells that recognize SARS-CoV-2 variants. name mentioned* literature_supp
34765543 The Hydropathy Index of the HCDR3 Region of the B-Cell Receptor Identifies Two Subgroups of IGHV-Mutated Chronic Lymphocytic Leukemia Patients With Distinct Outcome. name mentioned* literature_supp
34770845 Engineered Fully Human Single-Chain Monoclonal Antibodies to PIM2 Kinase. name mentioned* literature_supp
34785098 Landscapes and dynamic diversifications of B-cell receptor repertoires in COVID-19 patients. name mentioned* literature_supp
34788600 Immunizations with diverse sarbecovirus receptor-binding domains elicit SARS-CoV-2 neutralizing antibodies against a conserved site of vulnerability. name mentioned* literature_supp
34806017 CRIS: complete reconstruction of immunoglobulin V-D-J sequences from RNA-seq data. name mentioned* literature_supp
35108220 Ultrapotent neutralizing antibodies against SARS-CoV-2 with a high degree of mutation resistance. name mentioned* literature_supp
35205028 Next-Generation Sequencing Revealed a Distinct Immunoglobulin Repertoire with Specific Mutation Hotspots in Acute Myeloid Leukemia. name mentioned* literature_supp
35397794 A large-scale systematic survey reveals recurring molecular features of public antibody responses to SARS-CoV-2. name mentioned* literature_supp
35447092 Analysis of memory B cells identifies conserved neutralizing epitopes on the N-terminal domain of variant SARS-Cov-2 spike proteins. name mentioned* literature_supp
35545447 Gene prediction in the immunoglobulin loci. name mentioned* literature_supp
35592326 Pandemic, Epidemic, Endemic: B Cell Repertoire Analysis Reveals Unique Anti-Viral Responses to SARS-CoV-2, Ebola and Respiratory Syncytial Virus. name mentioned* literature_supp
35776090 Antibody evolution to SARS-CoV-2 after single-dose Ad26.COV2.S vaccine in humans. name mentioned* literature_supp
35837088 Characterizing Features of Human Circulating B Cells Carrying CLL-Like Stereotyped Immunoglobulin Rearrangements. name mentioned* literature_supp
36006380 Humoral immunity to SARS-CoV-2 elicited by combination COVID-19 vaccination regimens. name mentioned* literature_supp
36149398 Memory B cell responses to Omicron subvariants after SARS-CoV-2 mRNA breakthrough infection in humans. name mentioned* literature_supp
36328595 Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing. name mentioned* literature_supp
36473496 Antibody feedback regulates immune memory after SARS-CoV-2 mRNA vaccination. name mentioned* literature_supp
36574772 Immunoglobulin germline gene polymorphisms influence the function of SARS-CoV-2 neutralizing antibodies. name mentioned* literature_supp
36604758 Bacteroides-derived isovaleric acid enhances mucosal immunity by facilitating intestinal IgA response in broilers. name mentioned* literature_supp
36827454 Modeling and predicting the overlap of B- and T-cell receptor repertoires in healthy and SARS-CoV-2 infected individuals. name mentioned* literature_supp
36874132 Characterization of clonal immunoglobulin heavy V-D-J gene rearrangements in Chinese patients with chronic lymphocytic leukemia: Clinical features and molecular profiles. name mentioned* literature_supp
37368240 Memory B cell development elicited by mRNA booster vaccinations in the elderly. name mentioned* literature_supp
37640732 Engaging an HIV vaccine target through the acquisition of low B cell affinity. name mentioned* literature_supp
37957379 Dynamics and durability of HIV-1 neutralization are determined by viral replication. name mentioned* literature_supp
38065436 Into the Dark Serum Proteome: Personalized Features of IgG1 and IgA1 Repertoires in Severe COVID-19 Patients. name mentioned* literature_supp
39313500 Large B-cell lymphomas with CCND1 rearrangement have different immunoglobulin gene breakpoints and genomic profile than mantle cell lymphoma. name mentioned* literature_supp
39627383 Novel polymorphic and copy number diversity in the antibody IGH locus of South African individuals. name mentioned* literature_supp
39840032 An allelic atlas of immunoglobulin heavy chain variable regions reveals antibody binding epitope preference resilient to SARS-CoV-2 mutation escape. name mentioned* literature_supp
40066131 Characterization of Immunoglobulin Heavy Locus Rearrangements in Molecular Subtypes of Childhood B-Cell Precursor Acute Lymphoblastic Leukemia. name mentioned* literature_supp
40516049 Transient glycan shield reduction induces CD4-binding site broadly neutralizing antibodies in SHIV-infected macaques. name mentioned* literature_supp
40664667 High-resolution mapping of single cells in spatial context. name mentioned* literature_supp
40775219 Integrative multi-omics reveals a regulatory and exhausted T-cell landscape in CLL and identifies galectin-9 as an immunotherapy target. name mentioned* literature_supp
41606257 Allergen-specific human IgE isolated through an allergen-agnostic pipeline-understanding immune response and allergen recognition. name mentioned* literature_supp
41617721 Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity. name mentioned* literature_supp
41803327 IFN-gene signatures in B cells following influenza A and B virus infection and influenza vaccination. name mentioned* literature_supp
42078068 B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies. name mentioned* literature_supp
42256548 Genomic heterogeneity in primary cutaneous follicular center lymphomas reveals different clinicopathological subgroups. name mentioned* literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by HUSA, IMGT, KIARVA, OGRDB, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

PartSequenceSourceRSS UID
v_rsCACAGTGTGAGAAACCACATCCTCAGAGTGTCAGAAACC HUSA IMGT HUMAN-REXJRY

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)SplitSourceLeader UID
ATGGACTGGACCTGGAGGGTCTTCTGCTTGCTGGCTGTAGCTCCAGGTGCTCACTCC 46 + 11 nt HUSA IMGT HUMAN-L5S3O6

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/HUMAN-VB2FX4HMM/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

296 nt
CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTTTCCTGCAAGGCATCTGGATACACCTTCACCAGCTACTATATGCACTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAATAATCAACCCTAGTGGTGGTAGCACAAGCTACGCACAGAAGTTCCAGGGCAGAGTCACCATGACCAGGGACACGTCCACGAGCACAGTCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCGAGAGA

Amino-acid sequence (V-REGION)

98 aa
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGIINPSGGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAR

Published by the source, and consistent with the nucleotide sequence above. i