HUMAN-VBMPZE6BK

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesHomo sapiens LocusIGK TypeV FunctionalTrue Length287 nt

IGKV1-13*02, IGKV1D-13*02: a Homo sapiens IGK V allele sequence, 287 nt, functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Homo sapiens (NCBITAXON:9606)
Locus / type	IGK / V
Functional i	True
Length	287 nt
Protein UID i	HUMAN-VP-2CH2YU (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

287 nt

GCCATCCAGTTGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTCACCATCACTTGCCGGGCAAGTCAGGGCATTAGCAGTGCTTTAGCCTGGTATCAGCAGAAACCAGGGAAAGCTCCTAAGCTCCTGATCTATGATGCCTCCAGTTTGGAAAGTGGGGTCCCATCAAGGTTCAGCGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGATTTTGCAACTTATTACTGTCAACAGTTTAATAGTTACCCTCA

Amino-acid sequence (V-REGION)

95 aa

AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (HUMAN-VBMPZE6BK). None is canonical; they are labels, and the UID is the key.

Multiple allele designations. This one sequence is recorded under 2 different allele designations: IGKV1-13*02, IGKV1D-13*02. These are identical normalized nucleotide sequences with different attributed names.

Name	Scheme	Source(s)
IGKV1-13*02	IMGT	IMGT
IGKV1D-13*02	IMGT	IMGT, OGRDB

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

Name	Kind	Source(s)
KM455562.1	NCBI accession	ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:KM455562 GenBank: GENBANK:KM455562.1 GenBank: GENBANK:Z00006 IMGT: IGKV1-13*02 OGRDB: IGKV1D-13*02

Literature references 24 total · 1 verified · 23 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
25338678	Sequencing of the human IG light chain loci from a hydatidiform mole BAC library reveals locus-specific signatures of genetic diversity.	verified	ncbi_nucleotide
26382731	Isolation of nanomolar scFvs of non-human primate origin, cross-neutralizing botulinum neurotoxins A1 and A2 by targeting their heavy chain.	name mentioned^*	literature_supp
28974033	The European AntibotABE Framework Program and Its Update: Development of Innovative Botulinum Antibodies.	name mentioned^*	literature_supp
29376776	A natively paired antibody library yields drug leads with higher sensitivity and specificity than a randomly paired antibody library.	name mentioned^*	literature_supp
29545810	Repertoire Analysis of Antibody CDR-H3 Loops Suggests Affinity Maturation Does Not Typically Result in Rigidification.	name mentioned^*	literature_supp
29558968	BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data.	name mentioned^*	literature_supp
30697215	VH1-69 Utilizing Antibodies Are Capable of Mediating Non-neutralizing Fc-Mediated Effector Functions Against the Transmitted/Founder gp120.	name mentioned^*	literature_supp
31839985	More than one antibody of individual B cells revealed by single-cell immune profiling.	name mentioned^*	literature_supp
33048842	Antimalarial antibody repertoire defined by plasma IG proteomics and single B cell IG sequencing.	name mentioned^*	literature_supp
34126625	Naturally enhanced neutralizing breadth against SARS-CoV-2 one year after infection.	name mentioned^*	literature_supp
34587480	Paired heavy- and light-chain signatures contribute to potent SARS-CoV-2 neutralization in public antibody responses.	name mentioned^*	literature_supp
34788600	Immunizations with diverse sarbecovirus receptor-binding domains elicit SARS-CoV-2 neutralizing antibodies against a conserved site of vulnerability.	name mentioned^*	literature_supp
35383174	Efficient human-like antibody repertoire and hybridoma production in trans-chromosomic mice carrying megabase-sized human immunoglobulin loci.	name mentioned^*	literature_supp
35397794	A large-scale systematic survey reveals recurring molecular features of public antibody responses to SARS-CoV-2.	name mentioned^*	literature_supp
35776090	Antibody evolution to SARS-CoV-2 after single-dose Ad26.COV2.S vaccine in humans.	name mentioned^*	literature_supp
36006380	Humoral immunity to SARS-CoV-2 elicited by combination COVID-19 vaccination regimens.	name mentioned^*	literature_supp
36149398	Memory B cell responses to Omicron subvariants after SARS-CoV-2 mRNA breakthrough infection in humans.	name mentioned^*	literature_supp
36473496	Antibody feedback regulates immune memory after SARS-CoV-2 mRNA vaccination.	name mentioned^*	literature_supp
36827454	Modeling and predicting the overlap of B- and T-cell receptor repertoires in healthy and SARS-CoV-2 infected individuals.	name mentioned^*	literature_supp
37368240	Memory B cell development elicited by mRNA booster vaccinations in the elderly.	name mentioned^*	literature_supp
38205245	Comprehensive characterization and database construction of immune repertoire in the largest Chinese glioma cohort.	name mentioned^*	literature_supp
38844673	Resolving haplotype variation and complex genetic architecture in the human immunoglobulin kappa chain locus in individuals of diverse ancestry.	name mentioned^*	literature_supp
40664667	High-resolution mapping of single cells in spatial context.	name mentioned^*	literature_supp
41803327	IFN-gene signatures in B cells following influenza A and B virus infection and influenza vaccination.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, OGRDB, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGTGTTACAAACCCGAACATAAACC	IMGT	HUMAN-RJBSJM

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGAGGGTCCCCGCTCAGCTCCTGGGGCTTCTGCTGCTCTGGCTCCCAGGTGCCAGATGT	49 + 11 nt	IMGT	HUMAN-LED562
ATGGACATGAGGGTCCCCGCTCAGCTCCTGGGGCTTCTGCTGCTCTGGCTCCCAGGTGCCAGATGT	55 + 11 nt	IMGT	HUMAN-LZQYYA

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/HUMAN-VBMPZE6BK/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases