HUMAN-VBMTY2XAA

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesHomo sapiens LocusIGL TypeV FunctionalFalse Length290 nt

IGLV3-31*02: a Homo sapiens IGL V allele sequence, 290 nt, non-functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Homo sapiens (NCBITAXON:9606)
Locus / type	IGL / V
Functional i	False
Length	290 nt
Protein UID i	HUMAN-VP-LJBYZ7 (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

290 nt

TCCTCTGAGCTGAGTCAGGAGCCTGCAGTGTCTGTGTCCTTGGGATAGACAGCCAGGATCACCTGCCAGGGAGACAGCATAGAAGACTCCGTTGTAAACTGGTACAAGCAGAAGCCAAGCCAGGCCCCTGGGCTGGTCATCTAACTTAACAGTGTCCAGTCTTCAGGGATTCCTAAGAAATTCTCTGGCTCCAGCTCAGGGAACATGGCCACCCTGACCATCACTGGGATTCAGGTTGAAGACAAGGCTGACTATTACTGTCAGTCATGGGACAGCAGTCGTACTCATTC

Amino-acid sequence (V-REGION)

96 aa

SSELSQEPAVSVSLG*TARITCQGDSIEDSVVNWYKQKPSQAPGLVI*LNSVQSSGIPKKFSGSSSGNMATLTITGIQVEDKADYYCQSWDSSRTH

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (HUMAN-VBMTY2XAA). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGLV3-31*02	IMGT	IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

Name	Kind	Source(s)
Z22203.1	NCBI accession	ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:Z22203 GenBank: GENBANK:Z22203.1 IMGT: IGLV3-31*02

Literature references 1 total · 1 verified i

PubMed publications linked to this allele.

PMID	Title	Evidence	Source
7916694		verified	ncbi_nucleotide

Contributed by IMGT, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CGCGGTG	IMGT	HUMAN-R7AVZQ

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/HUMAN-VBMTY2XAA/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases