HUMAN-VC4UYYXIG

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesHomo sapiens LocusIGH TypeV FunctionalNone Length294 nt

IGHV3-37*02: a Homo sapiens IGH V allele sequence, 294 nt, not recorded. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Homo sapiens (NCBITAXON:9606)
Locus / type	IGH / V
Functional i	None
Length	294 nt
Protein UID i	HUMAN-VP-PSC3E7 (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

294 nt

GAGGTGCAGCTGGTAGAGTCTGGGGGAGACTTGGTACAGCTGTGGTGGGGTTGGGGGTGTCCTGAGACTCTCATGTGCAGCCTGCGGATTCATCTTGAGAAGCAATGACATGAACTGGGCCCACCGGGCTTCAAGAAAGGGGCTGGAATGGGTCTCATACATTAGTGCTAGTGGTGGTAGCCTATACTATGCAGACACTGAAGGGTAGATTCACCATCTCTAGAGACAATGGCAAGAACATGCTGTACTTGCAAATGAACAGTCTGAGAGATGAGGACTCGGCTGTGTGAGAGA

Amino-acid sequence (V-REGION)

98 aa

EVQLVESGGDLVQLWWGWGCPETLMCSLRIHLEKQ*HELGPPGFKKGAGMGLIH*C*WW*PILCRH*RVDSPSLETMARTCCTCK*TV*EMRTRLCER

Translated here from the nucleotide sequence; no source published a protein for this allele. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (HUMAN-VC4UYYXIG). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV3-37*02	IMGT	IMGT

External records i

IMGT: IGHV3-37*02

Literature references 2 total · 1 sequence-in-paper · 1 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
34764956	Novel Allele Detection Tool Benchmark and Application With Antibody Repertoire Sequencing Dataset.	sequence in paper	literature_supp
36328595	Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CATGGTGAGGGGAAATCAGTATGAGCCCAGCCAGAAACC	IMGT	HUMAN-R6RB2K

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGTTGTTTGGGCTGAGCTGGGCTTTCCTTTTTACTATTTTAAGAGGTGTGCAGTAT	46 + 11 nt	IMGT	HUMAN-LRHQRP

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/HUMAN-VC4UYYXIG/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases