HUMAN-VO5MCUNZC

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesHomo sapiens LocusIGL TypeV FunctionalNone Length284 nt

IGLV3-9*03: a Homo sapiens IGL V allele sequence, 284 nt, not recorded. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Homo sapiens (NCBITAXON:9606)
Locus / type	IGL / V
Functional i	None
Length	284 nt
Protein UID i	HUMAN-VP-XBSJHS (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

284 nt

TCCTATGAGCTGACTCAGCCACTCTCAGTGTCAGTGGCCCTGGGACAGGCGGCCAGGATTACCTGTGGGGGAAACAACCTTGGATATAAAATGTGCACTGGTACCAGCAGAAGCCAGGCCAGGCCCCTGTGCTGGTCATCTATAGGGATAACAACCGGCCCTCTGGGATCCCTGAGCGATTCTCTGGCTCCAACTCGGGGAACACGGCCACCCTGACCATCAGCAGAGCCCAAGCCGGGGATGAGGCTGACTATTACTGTCAGGTGTGGGACAGCAGCACTGCA

Amino-acid sequence (V-REGION)

94 aa

SYELTQPLSVSVALGQAARITCGGNNLGYKMCTGTSRSQARPLCWSSIGITTGPLGSLSDSLAPTRGTRPP*PSAEPKPGMRLTITVRCGTAAL

Translated here from the nucleotide sequence; no source published a protein for this allele. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (HUMAN-VO5MCUNZC). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGLV3-9*03	IMGT	IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

Name	Kind	Source(s)
MN202410.1	NCBI accession	ncbi_nucleotide

External records i

NCBI nucleotide: link IMGT: IGLV3-9*03

Contributed by IMGT, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGGCCTGGACCGCTCTCCTTCTGAGCCTCCTTGCTCACTTTACAGGTTCTGTGGCC	46 + 11 nt	IMGT	HUMAN-LZPTDP

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/HUMAN-VO5MCUNZC/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases