AIRBabel immunoglobulin and T-cell receptor allele sequences · leaders · RSSs

← back to search

HUMAN-VRLY4UEZU

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesHomo sapiens LocusIGH TypeV FunctionalTrue Length302 nt
SpeciesHomo sapiens (NCBITAXON:9606)
Locus / typeIGH / V
Functional iTrue
Length302 nt
Protein UID iHUMAN-VP-Y673VQ (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (HUMAN-VRLY4UEZU). None is canonical; they are labels, and the UID is the key.

NameSchemeSource(s)
IGHV3-15*08 IMGT IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

NameKindSource(s)
M99400.1 NCBI accession ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:M99400 GenBank: GENBANK:M99400.1 IMGT: IGHV3-15*08

Literature references 8 total · 1 verified · 2 sequence-in-paper · 5 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMIDTitleEvidenceSource
8335909 verified ncbi_nucleotide
34764956 Novel Allele Detection Tool Benchmark and Application With Antibody Repertoire Sequencing Dataset. sequence in paper literature_supp
38643233 An ancestral SARS-CoV-2 vaccine induces anti-Omicron variants antibodies by hypermutation. sequence in paper literature_supp
29558968 BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data. name mentioned* literature_supp
33048842 Antimalarial antibody repertoire defined by plasma IG proteomics and single B cell IG sequencing. name mentioned* literature_supp
34484220 RAPID: A Rep-Seq Dataset Analysis Platform With an Integrated Antibody Database. name mentioned* literature_supp
41617721 Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity. name mentioned* literature_supp
42078068 B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies. name mentioned* literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)SplitSourceLeader UID
GCTATTTTAAAAGGTGTCCAGTGT 13 + 11 nt IMGT HUMAN-LR54ER

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/HUMAN-VRLY4UEZU/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

302 nt
GAGGTGCAGCTGGTGGAGTCTGCGGGAGGCTTGGTACAGCCTGGGGGGTCCCTTAGACTCTCCTGTGCAGCCTCTGGATTCACTTGCAGTAACGCCTGGATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTTGGCTGTATTAAAAGCAAAGCTAATGGTGGGACAACAGACTACGCTGCACCTGTGAAAGGCAGATTCACCATCTCAAGAGATGATTCAAAAAACACGCTGTATCTGCAAATGATCAGCCTGAAAACCGAGGACACGGCCGTGTATTACTGTACCACAGG

Amino-acid sequence (V-REGION)

100 aa
EVQLVESAGGLVQPGGSLRLSCAASGFTCSNAWMSWVRQAPGKGLEWVGCIKSKANGGTTDYAAPVKGRFTISRDDSKNTLYLQMISLKTEDTAVYYCTT

Published by the source, and consistent with the nucleotide sequence above. i