AIRBabel immunoglobulin and T-cell receptor allele sequences · leaders · RSSs

← back to search

HUMAN-VTATGGDMS

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesHomo sapiens LocusIGK TypeV FunctionalTrue Length287 nt
SpeciesHomo sapiens (NCBITAXON:9606)
Locus / typeIGK / V
Functional iTrue
Length287 nt
Protein UID iHUMAN-VP-GOPZJ2 (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (HUMAN-VTATGGDMS). None is canonical; they are labels, and the UID is the key.

NameSchemeSource(s)
IGKV1-17*02 IMGT IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

NameKindSource(s)
D88255.1 NCBI accession ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:D88255 GenBank: GENBANK:D88255.1 IMGT: IGKV1-17*02

Literature references 8 total · 1 verified · 7 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMIDTitleEvidenceSource
8878436 verified ncbi_nucleotide
31839985 More than one antibody of individual B cells revealed by single-cell immune profiling. name mentioned* literature_supp
34587480 Paired heavy- and light-chain signatures contribute to potent SARS-CoV-2 neutralization in public antibody responses. name mentioned* literature_supp
35397794 A large-scale systematic survey reveals recurring molecular features of public antibody responses to SARS-CoV-2. name mentioned* literature_supp
35447092 Analysis of memory B cells identifies conserved neutralizing epitopes on the N-terminal domain of variant SARS-Cov-2 spike proteins. name mentioned* literature_supp
35776090 Antibody evolution to SARS-CoV-2 after single-dose Ad26.COV2.S vaccine in humans. name mentioned* literature_supp
36328595 Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing. name mentioned* literature_supp
40664667 High-resolution mapping of single cells in spatial context. name mentioned* literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

PartSequenceSourceRSS UID
v_rsCACAGTGTTACACACCCGAACATAAAACC IMGT HUMAN-RUFAHD

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)SplitSourceLeader UID
ATGAGGGTCCCCGCTCAGCTCCTGGGGCTCCTGCTGCTCTGGTTCCCAGGTGCCAGGTGT 49 + 11 nt IMGT HUMAN-L6L3YQ

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/HUMAN-VTATGGDMS/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

287 nt
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTCACCATCACTTGCCGGGCAAGTCAGGGCATTAGAAATGATTTAGGCTGGTATCAGCAGAAACCAGGGAAAGCCCCTAAGCGCCTGATCTATGCTGCATCCAGTTTGCAAAGTGGGGTCCCATCAAGGTTCAGCGGCAGTGGATCTGGGACAGAATTCACTCTCACAATCAGCAACCTGCAGCCTGAAGATTTTGCAACTTATTACTGTCTACAGCATAATAGTTACCCTCC

Amino-acid sequence (V-REGION)

95 aa
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPSRFSGSGSGTEFTLTISNLQPEDFATYYCLQHNSYP

Published by the source, and consistent with the nucleotide sequence above. i