HUMAN-VU4SKQKFH

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesHomo sapiens LocusIGH TypeV FunctionalTrue Length296 nt

IGHV3-64*02: a Homo sapiens IGH V allele sequence, 296 nt, functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Homo sapiens (NCBITAXON:9606)
Locus / type	IGH / V
Functional i	True
Length	296 nt
Protein UID i	HUMAN-VP-DR2LZR (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

296 nt

GAGGTGCAGCTGGTGGAGTCTGGGGAAGGCTTGGTCCAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTCAGTAGCTATGCTATGCACTGGGTCCGCCAGGCTCCAGGGAAGGGACTGGAATATGTTTCAGCTATTAGTAGTAATGGGGGTAGCACATATTATGCAGACTCTGTGAAGGGCAGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTTCAAATGGGCAGCCTGAGAGCTGAGGACATGGCTGTGTATTACTGTGCGAGAGA

Amino-acid sequence (V-REGION)

98 aa

EVQLVESGEGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEYVSAISSNGGSTYYADSVKGRFTISRDNSKNTLYLQMGSLRAEDMAVYYCAR

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (HUMAN-VU4SKQKFH). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV3-64*02	IMGT	IMGT, KIARVA, OGRDB

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

Name	Kind	Source(s)
AB019437.1	NCBI accession	ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:AB019437 GenBank: GENBANK:AB019437.1 IMGT: IGHV3-64*02 OGRDB: IGHV3-64*02

Literature references 22 total · 1 verified · 3 sequence-in-paper · 18 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
9841928		verified	ncbi_nucleotide
34764956	Novel Allele Detection Tool Benchmark and Application With Antibody Repertoire Sequencing Dataset.	sequence in paper	literature_supp
37076511	Vaccination of SARS-CoV-2-infected individuals expands a broad range of clonally diverse affinity-matured B cell lineages.	sequence in paper	literature_supp
38643233	An ancestral SARS-CoV-2 vaccine induces anti-Omicron variants antibodies by hypermutation.	sequence in paper	literature_supp
31839985	More than one antibody of individual B cells revealed by single-cell immune profiling.	name mentioned^*	literature_supp
32365177	Polymorphisms in human immunoglobulin heavy chain variable genes and their upstream regions.	name mentioned^*	literature_supp
32636395	IgCaller for reconstructing immunoglobulin gene rearrangements and oncogenic translocations from whole-genome sequencing in lymphoid neoplasms.	name mentioned^*	literature_supp
33048842	Antimalarial antibody repertoire defined by plasma IG proteomics and single B cell IG sequencing.	name mentioned^*	literature_supp
34040612	Characterization of DNA G-Quadruplex Structures in Human Immunoglobulin Heavy Variable (IGHV) Genes.	name mentioned^*	literature_supp
34484220	RAPID: A Rep-Seq Dataset Analysis Platform With an Integrated Antibody Database.	name mentioned^*	literature_supp
34614412	mRNA vaccination of naive and COVID-19-recovered individuals elicits potent memory B cells that recognize SARS-CoV-2 variants.	name mentioned^*	literature_supp
35397794	A large-scale systematic survey reveals recurring molecular features of public antibody responses to SARS-CoV-2.	name mentioned^*	literature_supp
35776090	Antibody evolution to SARS-CoV-2 after single-dose Ad26.COV2.S vaccine in humans.	name mentioned^*	literature_supp
36149398	Memory B cell responses to Omicron subvariants after SARS-CoV-2 mRNA breakthrough infection in humans.	name mentioned^*	literature_supp
36328595	Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing.	name mentioned^*	literature_supp
36353774	High activation levels maintained in receptor-binding domain-specific memory B cells in people with severe coronavirus disease 2019.	name mentioned^*	literature_supp
37548401	IGHV allele similarity clustering improves genotype inference from adaptive immune receptor repertoire sequencing data.	name mentioned^*	literature_supp
39840032	An allelic atlas of immunoglobulin heavy chain variable regions reveals antibody binding epitope preference resilient to SARS-CoV-2 mutation escape.	name mentioned^*	literature_supp
40664667	High-resolution mapping of single cells in spatial context.	name mentioned^*	literature_supp
41617721	Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity.	name mentioned^*	literature_supp
41803327	IFN-gene signatures in B cells following influenza A and B virus infection and influenza vaccination.	name mentioned^*	literature_supp
42078068	B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, KIARVA, OGRDB, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGTGAGGAGAAGTTAATGTGGGACCATGCAGAAACC	IMGT	HUMAN-RTJF5F

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGGAGTTTGGGCTGAGCTGGGTTTTCCTTGTTGCTATTTTTAAAGGTGTCCAGTGT	46 + 11 nt	IMGT	HUMAN-LU2T53

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/HUMAN-VU4SKQKFH/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases