HUMAN-VXR3MXHR3

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesHomo sapiens LocusIGH TypeV FunctionalFalse Length300 nt

IGHV3/OR15-7*01: a Homo sapiens IGH V allele sequence, 300 nt, non-functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Homo sapiens (NCBITAXON:9606)
Locus / type	IGH / V
Functional i	False
Length	300 nt
Protein UID i	HUMAN-VP-2H4OXQ (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

300 nt

GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTCCAGCCTGGGGGTTCTCTGAGACTCTCATGTGCAGCCTCTGGATTCACCTTCAGTGACCACTACATGAGCTGGGTCCGCCAGGCTCAAGGGAAAGGGCTAGAGTTGGTAGGTTTAATAAGAAACAAAGCTAACAGTTACACGACAGAATATGCTGCGTCTGTGAAAGGCAGACTTACCATCTCAAGAGAGGATTCAAAGAACACGATGTATCTGCAAATGAGCAACCTGAAAACCGAGGACTTGGCCGTGTATTACTGTGCTAGA

Amino-acid sequence (V-REGION)

100 aa

EVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMSWVRQAQGKGLELVGLIRNKANSYTTEYAASVKGRLTISREDSKNTMYLQMSNLKTEDLAVYYCAR

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (HUMAN-VXR3MXHR3). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV3/OR15-7*01	IMGT	IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

Name	Kind	Source(s)
Z29597.1	NCBI accession	ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:Z29597 GenBank: GENBANK:Z29597.1 IMGT: IGHV3/OR15-7*01

Literature references 3 total · 1 verified · 2 sequence-in-paper i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence.

PMID	Title	Evidence	Source
7951227		verified	ncbi_nucleotide
34764956	Novel Allele Detection Tool Benchmark and Application With Antibody Repertoire Sequencing Dataset.	sequence in paper	literature_supp
35545447	Gene prediction in the immunoglobulin loci.	sequence in paper	literature_supp

Contributed by IMGT, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/HUMAN-VXR3MXHR3/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases