HUMAN-VZXXSJQD6

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesHomo sapiens LocusIGL TypeV FunctionalFalse Length297 nt

IGLV2-34*01: a Homo sapiens IGL V allele sequence, 297 nt, non-functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Homo sapiens (NCBITAXON:9606)
Locus / type	IGL / V
Functional i	False
Length	297 nt
Protein UID i	HUMAN-VP-LLH36K (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

297 nt

CAGTCTGTTCTGACTCAGCCTCGCTCAGTGTCCAGGTCTCCTGGACAGTAGGTTACTATCTTCTGCACTGGAACCAGCAGTGACATTGGGGGTTATGACCTTGTCTCCTGGTGCCAGTAGCACCCAGGCAAAGCCCCCAAACTCATGATTTATGATGTCGCTAATTGGCCCTCAGGGGCCCCTGGTTGCTTCTCTGGCTCCAAGTCTGGCAACACGGCCTCCCTGACCATCTCTGGGCTCCAGGCTGAGGACGAGGCTGATTATTACTGCAGCTCATATGCAGGCAGCTACAATTTC

Amino-acid sequence (V-REGION)

99 aa

QSVLTQPRSVSRSPGQ*VTIFCTGTSSDIGGYDLVSWCQ*HPGKAPKLMIYDVANWPSGAPGCFSGSKSGNTASLTISGLQAEDEADYYCSSYAGSYNF

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (HUMAN-VZXXSJQD6). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGLV2-34*01	IMGT	IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

Name	Kind	Source(s)
D87013.1	NCBI accession	ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:D87013 GenBank: GENBANK:D87013.1 IMGT: IGLV2-34*01

Literature references 3 total · 1 verified · 2 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
9074928		verified	ncbi_nucleotide
31839985	More than one antibody of individual B cells revealed by single-cell immune profiling.	name mentioned^*	literature_supp
40664667	High-resolution mapping of single cells in spatial context.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGGCCTGGGCTCTGCTCCTTCTCACCCTCCTCACTCAGGGCACAGGGTCCTGGGCC	46 + 11 nt	IMGT	HUMAN-LMSTBB

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/HUMAN-VZXXSJQD6/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases