MOUSE-VC66KJUWK

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMus musculus LocusIGK TypeV FunctionalTrue Length302 nt

IGKV1-110*02: a Mus musculus IGK V allele sequence, 302 nt, functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Mus musculus (NCBITAXON:10090)
Locus / type	IGK / V
Functional i	True
Length	302 nt
Protein UID i	MOUSE-VP-Q56CUN (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

302 nt

GATGTTGTGATGACCCAAACTCCACTCTCCCTGCCTGTCAGTCTTGGAGATCAAGCTTCCATCTCTTGCAGATCTAGTCAGAGCCTTGTACACAGCAATGGAAACACCTATTTATATTGGTACCTGCAGAAGCCAGGCCAGTCTCCAAAGCTCCTGATCTACAGGGTTTCCAACCGATTTTCTGGGGTCCCAGACAGGTTCAGTGGCAGTGGATCAGGGACAGATTTCACACTCAAGATCAGCAGAGTGGAGGCTGAGGATCTGGGAGTTTATTTCTGCTTTCAAGGTACACATGTTCCTCA

Amino-acid sequence (V-REGION)

100 aa

DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLYWYLQKPGQSPKLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCFQGTHVP

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (MOUSE-VC66KJUWK). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGKV1-110*02	IMGT	IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

Name	Kind	Source(s)
M28132.1	NCBI accession	ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:M28132 GenBank: GENBANK:M28132.1 IMGT: IGKV1-110*02

Literature references 3 total · 1 verified · 2 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
2567773		verified	ncbi_nucleotide
29545810	Repertoire Analysis of Antibody CDR-H3 Loops Suggests Affinity Maturation Does Not Typically Result in Rigidification.	name mentioned^*	literature_supp
40338637	Comprehensive analysis of nasal IgA antibodies induced by intranasal administration of the SARS-CoV-2 spike protein.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGTGATACAGACCCTAACAAAAATA	IMGT	MOUSE-RKWPYJ

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGAAGTTGCCTGTTAGGTTGTTGGTGCTGTTGTTCTGGATTCCTGCTTCCAGCAGT	46 + 11 nt	IMGT	MOUSE-LWGINQ

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/MOUSE-VC66KJUWK/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases