AIRBabel immunoglobulin and T-cell receptor allele sequences · leaders · RSSs

← back to search

MOUSE-VCV2RDOKK

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMus musculus LocusIGH TypeV FunctionalTrue Length294 nt
SpeciesMus musculus (NCBITAXON:10090)
Locus / typeIGH / V
Functional iTrue
Length294 nt
Protein UID iMOUSE-VP-NWNGMC (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (MOUSE-VCV2RDOKK). None is canonical; they are labels, and the UID is the key.

NameSchemeSource(s)
IGHV1-69*02 IMGT IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

NameKindSource(s)
X00160.1 NCBI accession ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:X00160 GenBank: GENBANK:X00160.1 IMGT: IGHV1-69*02

Literature references 33 total · 1 verified · 32 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMIDTitleEvidenceSource
6416826 verified ncbi_nucleotide
22586427 Pandemic H1N1 Influenza Infection and Vaccination in Humans Induces Cross-Protective Antibodies that Target the Hemagglutinin Stem. name mentioned* literature_supp
29545810 Repertoire Analysis of Antibody CDR-H3 Loops Suggests Affinity Maturation Does Not Typically Result in Rigidification. name mentioned* literature_supp
31839985 More than one antibody of individual B cells revealed by single-cell immune profiling. name mentioned* literature_supp
32156260 Tracing CLL-biased stereotyped immunoglobulin gene rearrangements in normal B cell subsets using a high-throughput immunogenetic approach. name mentioned* literature_supp
32636395 IgCaller for reconstructing immunoglobulin gene rearrangements and oncogenic translocations from whole-genome sequencing in lymphoid neoplasms. name mentioned* literature_supp
33048842 Antimalarial antibody repertoire defined by plasma IG proteomics and single B cell IG sequencing. name mentioned* literature_supp
33485405 Enhancement versus neutralization by SARS-CoV-2 antibodies from a convalescent donor associates with distinct epitopes on the RBD. name mentioned* literature_supp
33717051 Poorly Expressed Alleles of Several Human Immunoglobulin Heavy Chain Variable Genes are Common in the Human Population. name mentioned* literature_supp
33843586 Distinct clonal evolution of B-cells in HIV controllers with neutralizing antibody breadth. name mentioned* literature_supp
34126625 Naturally enhanced neutralizing breadth against SARS-CoV-2 one year after infection. name mentioned* literature_supp
34614412 mRNA vaccination of naive and COVID-19-recovered individuals elicits potent memory B cells that recognize SARS-CoV-2 variants. name mentioned* literature_supp
34671351 Computational Inference, Validation, and Analysis of 5'UTR-Leader Sequences of Alleles of Immunoglobulin Heavy Chain Variable Genes. name mentioned* literature_supp
34785098 Landscapes and dynamic diversifications of B-cell receptor repertoires in COVID-19 patients. name mentioned* literature_supp
34788600 Immunizations with diverse sarbecovirus receptor-binding domains elicit SARS-CoV-2 neutralizing antibodies against a conserved site of vulnerability. name mentioned* literature_supp
34813501 B cell receptor isotypes differentially associate with cell signaling, kinetics, and outcome in chronic lymphocytic leukemia. name mentioned* literature_supp
35447092 Analysis of memory B cells identifies conserved neutralizing epitopes on the N-terminal domain of variant SARS-Cov-2 spike proteins. name mentioned* literature_supp
35720344 A BALB/c IGHV Reference Set, Defined by Haplotype Analysis of Long-Read VDJ-C Sequences From F1 (BALB/c x C57BL/6) Mice. name mentioned* literature_supp
35837088 Characterizing Features of Human Circulating B Cells Carrying CLL-Like Stereotyped Immunoglobulin Rearrangements. name mentioned* literature_supp
36006380 Humoral immunity to SARS-CoV-2 elicited by combination COVID-19 vaccination regimens. name mentioned* literature_supp
36149398 Memory B cell responses to Omicron subvariants after SARS-CoV-2 mRNA breakthrough infection in humans. name mentioned* literature_supp
36827454 Modeling and predicting the overlap of B- and T-cell receptor repertoires in healthy and SARS-CoV-2 infected individuals. name mentioned* literature_supp
37368240 Memory B cell development elicited by mRNA booster vaccinations in the elderly. name mentioned* literature_supp
38435425 Analysis of immunoglobulin/T-cell receptor repertoires by high-throughput RNA sequencing reveals a continuous dynamic of positive clonal selection in follicular lymphoma. name mentioned* literature_supp
39840032 An allelic atlas of immunoglobulin heavy chain variable regions reveals antibody binding epitope preference resilient to SARS-CoV-2 mutation escape. name mentioned* literature_supp
40066131 Characterization of Immunoglobulin Heavy Locus Rearrangements in Molecular Subtypes of Childhood B-Cell Precursor Acute Lymphoblastic Leukemia. name mentioned* literature_supp
40664667 High-resolution mapping of single cells in spatial context. name mentioned* literature_supp
40710355 Pathogenesis of Graves' Disease Determined Using Single-Cell Sequencing with Thyroid Autoantigen Peptide Stimulation in B Cells. name mentioned* literature_supp
41606257 Allergen-specific human IgE isolated through an allergen-agnostic pipeline-understanding immune response and allergen recognition. name mentioned* literature_supp
41617721 Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity. name mentioned* literature_supp
41634487 Identification of a potent V3 glycan site broadly neutralizing antibody targeting an N332gp120 glycan-independent epitope. name mentioned* literature_supp
41803327 IFN-gene signatures in B cells following influenza A and B virus infection and influenza vaccination. name mentioned* literature_supp
42078068 B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies. name mentioned* literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

PartSequenceSourceRSS UID
v_rsCACAGTGTTGTAACCACATTCTGAGAGTGTTAGAAACCC IMGT MOUSE-RYOTIX

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)SplitSourceLeader UID
ATGGGATGGAGCTGTATCATCCTCTTCTTGGTATCAACAGCTACAGGTGTCCACTCC 46 + 11 nt IMGT MOUSE-LNW6ZC

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/MOUSE-VCV2RDOKK/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

294 nt
CAGGTCCAACTGCAGCAGCCTGGGGCTGAGCTTGTGAAGCCTGGGGCTTCAGTGAAGCTGTCCTGCAAGGCTTCTGGCTACACCTTCACCAGCTACTGGATGCACTGGGTGAAGCAGAGGCCTGGACAAGGCCTTGAGTGGATCGGAGAGATTGATCCTTCTGATAGTTATACTAACTACAATCAAAAGTTCAAGGGCAAGGCCACATTGACTGTAGACAAATCCTCCAGCACAGCCTACATGCAGCTCAGCAGCCTGACATCTGAGGACTCTGCGGTCTATTACTGTGCAAGA

Amino-acid sequence (V-REGION)

98 aa
QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGEIDPSDSYTNYNQKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYYCAR

Published by the source, and consistent with the nucleotide sequence above. i