MOUSE-VDRC4BUIE

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMus musculus LocusIGH TypeV FunctionalNone Length321 nt

Species	Mus musculus (NCBITAXON:10090)
Locus / type	IGH / V
Functional i	None
Length	321 nt
Protein UID i	MOUSE-VP-URSIO6 (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (MOUSE-VDRC4BUIE). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV1-2*02	IMGT	IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

Name	Kind	Source(s)
MW177290.1	NCBI accession	ncbi_nucleotide

External records i

NCBI nucleotide: link IMGT: IGHV1-2*02

Literature references 68 total · 1 sequence-in-paper · 67 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
35720344	A BALB/c IGHV Reference Set, Defined by Haplotype Analysis of Long-Read VDJ-C Sequences From F1 (BALB/c x C57BL/6) Mice.	sequence in paper	literature_supp
22111995	Isolation of a nanomolar scFv inhibiting the endopeptidase activity of botulinum toxin A, by single-round panning of an immune phage-displayed library of macaque origin.	name mentioned^*	literature_supp
24032032	The shape of the lymphocyte receptor repertoire: lessons from the B cell receptor.	name mentioned^*	literature_supp
25221552	The Antibody Germline/Maturation Hypothesis, Elicitation of Broadly Neutralizing Antibodies Against HIV-1 and Cord Blood IgM Repertoires.	name mentioned^*	literature_supp
26086076	High Inter-Individual Diversity of Point Mutations, Insertions, and Deletions in Human Influenza Virus Nucleoprotein-Specific Memory B Cells.	name mentioned^*	literature_supp
26440796	Development of Human-Like scFv-Fc Neutralizing Botulinum Neurotoxin E.	name mentioned^*	literature_supp
26802217	The Diversity and Molecular Evolution of B-Cell Receptors during Infection.	name mentioned^*	literature_supp
27074145	Maximum-Entropy Models of Sequenced Immune Repertoires Predict Antigen-Antibody Affinity.	name mentioned^*	literature_supp
27525066	Repertoire comparison of the B-cell receptor-encoding loci in humans and rhesus macaques by next-generation sequencing.	name mentioned^*	literature_supp
28725665	Data on haplotype-supported immunoglobulin germline gene inference.	name mentioned^*	literature_supp
29180996	Antibody Heavy Chain Variable Domains of Different Germline Gene Origins Diversify through Different Paths.	name mentioned^*	literature_supp
29187855	CD4-Binding Site Directed Cross-Neutralizing scFv Monoclonals from HIV-1 Subtype C Infected Indian Children.	name mentioned^*	literature_supp
29545810	Repertoire Analysis of Antibody CDR-H3 Loops Suggests Affinity Maturation Does Not Typically Result in Rigidification.	name mentioned^*	literature_supp
29558968	BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data.	name mentioned^*	literature_supp
30697215	VH1-69 Utilizing Antibodies Are Capable of Mediating Non-neutralizing Fc-Mediated Effector Functions Against the Transmitted/Founder gp120.	name mentioned^*	literature_supp
31839985	More than one antibody of individual B cells revealed by single-cell immune profiling.	name mentioned^*	literature_supp
31974198	Genomic arrays identify high-risk chronic lymphocytic leukemia with genomic complexity: a multi-center study.	name mentioned^*	literature_supp
32075963	Immune checkpoint modulation enhances HIV-1 antibody induction.	name mentioned^*	literature_supp
32156260	Tracing CLL-biased stereotyped immunoglobulin gene rearrangements in normal B cell subsets using a high-throughput immunogenetic approach.	name mentioned^*	literature_supp
32425948	AID Overlapping and Polη Hotspots Are Key Features of Evolutionary Variation Within the Human Antibody Heavy Chain (IGHV) Genes.	name mentioned^*	literature_supp
32636395	IgCaller for reconstructing immunoglobulin gene rearrangements and oncogenic translocations from whole-genome sequencing in lymphoid neoplasms.	name mentioned^*	literature_supp
33180672	Hiding in plain sight: structure and sequence analysis reveals the importance of the antibody DE loop for antibody-antigen binding.	name mentioned^*	literature_supp
33717051	Poorly Expressed Alleles of Several Human Immunoglobulin Heavy Chain Variable Genes are Common in the Human Population.	name mentioned^*	literature_supp
33843586	Distinct clonal evolution of B-cells in HIV controllers with neutralizing antibody breadth.	name mentioned^*	literature_supp
34040612	Characterization of DNA G-Quadruplex Structures in Human Immunoglobulin Heavy Variable (IGHV) Genes.	name mentioned^*	literature_supp
34126625	Naturally enhanced neutralizing breadth against SARS-CoV-2 one year after infection.	name mentioned^*	literature_supp
34242577	In vitro and in vivo functions of SARS-CoV-2 infection-enhancing and neutralizing antibodies.	name mentioned^*	literature_supp
34489473	Vaccine genetics of IGHV1-2 VRC01-class broadly neutralizing antibody precursor naïve human B cells.	name mentioned^*	literature_supp
34614412	mRNA vaccination of naive and COVID-19-recovered individuals elicits potent memory B cells that recognize SARS-CoV-2 variants.	name mentioned^*	literature_supp
34671351	Computational Inference, Validation, and Analysis of 5'UTR-Leader Sequences of Alleles of Immunoglobulin Heavy Chain Variable Genes.	name mentioned^*	literature_supp
34765543	The Hydropathy Index of the HCDR3 Region of the B-Cell Receptor Identifies Two Subgroups of IGHV-Mutated Chronic Lymphocytic Leukemia Patients With Distinct Outcome.	name mentioned^*	literature_supp
34785098	Landscapes and dynamic diversifications of B-cell receptor repertoires in COVID-19 patients.	name mentioned^*	literature_supp
35087534	VDJ Gene Usage in IgM Repertoires of Rhesus and Cynomolgus Macaques.	name mentioned^*	literature_supp
35205028	Next-Generation Sequencing Revealed a Distinct Immunoglobulin Repertoire with Specific Mutation Hotspots in Acute Myeloid Leukemia.	name mentioned^*	literature_supp
35447092	Analysis of memory B cells identifies conserved neutralizing epitopes on the N-terminal domain of variant SARS-Cov-2 spike proteins.	name mentioned^*	literature_supp
35592326	Pandemic, Epidemic, Endemic: B Cell Repertoire Analysis Reveals Unique Anti-Viral Responses to SARS-CoV-2, Ebola and Respiratory Syncytial Virus.	name mentioned^*	literature_supp
35776090	Antibody evolution to SARS-CoV-2 after single-dose Ad26.COV2.S vaccine in humans.	name mentioned^*	literature_supp
35837088	Characterizing Features of Human Circulating B Cells Carrying CLL-Like Stereotyped Immunoglobulin Rearrangements.	name mentioned^*	literature_supp
36006380	Humoral immunity to SARS-CoV-2 elicited by combination COVID-19 vaccination regimens.	name mentioned^*	literature_supp
36149398	Memory B cell responses to Omicron subvariants after SARS-CoV-2 mRNA breakthrough infection in humans.	name mentioned^*	literature_supp
36328595	Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing.	name mentioned^*	literature_supp
36351924	Single-cell profiling reveals a memory B cell-like subtype of follicular lymphoma with increased transformation risk.	name mentioned^*	literature_supp
36395347	Complementary antibody lineages achieve neutralization breadth in an HIV-1 infected elite neutralizer.	name mentioned^*	literature_supp
36473496	Antibody feedback regulates immune memory after SARS-CoV-2 mRNA vaccination.	name mentioned^*	literature_supp
36591518	Evidence of somatic hypermutation in the antigen binding sites of patients with CLL harboring IGHV genes with 100% germline identity.	name mentioned^*	literature_supp
36827454	Modeling and predicting the overlap of B- and T-cell receptor repertoires in healthy and SARS-CoV-2 infected individuals.	name mentioned^*	literature_supp
36968243	Efficient isolation of rare B cells using next-generation antigen barcoding.	name mentioned^*	literature_supp
37368240	Memory B cell development elicited by mRNA booster vaccinations in the elderly.	name mentioned^*	literature_supp
37533642	TRAPnSeq allows high-throughput profiling of antigen-specific antibody-secreting cells.	name mentioned^*	literature_supp
37640732	Engaging an HIV vaccine target through the acquisition of low B cell affinity.	name mentioned^*	literature_supp
38435425	Analysis of immunoglobulin/T-cell receptor repertoires by high-throughput RNA sequencing reveals a continuous dynamic of positive clonal selection in follicular lymphoma.	name mentioned^*	literature_supp
38467663	Human immunoglobulin gene allelic variation impacts germline-targeting vaccine priming.	name mentioned^*	literature_supp
39840032	An allelic atlas of immunoglobulin heavy chain variable regions reveals antibody binding epitope preference resilient to SARS-CoV-2 mutation escape.	name mentioned^*	literature_supp
40066131	Characterization of Immunoglobulin Heavy Locus Rearrangements in Molecular Subtypes of Childhood B-Cell Precursor Acute Lymphoblastic Leukemia.	name mentioned^*	literature_supp
40432083	Isolation and Characterization of E8 Monoclonal Antibodies from Donors Vaccinated with Recombinant Vaccinia Vaccine with Efficient Neutralization of Authentic Monkeypox Virus.	name mentioned^*	literature_supp
40433552	Antigen selection reflected in the subclonal architecture of the B-cell receptor immunoglobulin gene repertoire in splenic marginal zone lymphoma.	name mentioned^*	literature_supp
40516049	Transient glycan shield reduction induces CD4-binding site broadly neutralizing antibodies in SHIV-infected macaques.	name mentioned^*	literature_supp
40588565	Disease-specific U1 spliceosomal RNA mutations in mature B-cell neoplasms.	name mentioned^*	literature_supp
40664667	High-resolution mapping of single cells in spatial context.	name mentioned^*	literature_supp
40675999	Optimizing human B cell repertoire analyses to interpret clinical data and design sequential HIV vaccines.	name mentioned^*	literature_supp
40775219	Integrative multi-omics reveals a regulatory and exhausted T-cell landscape in CLL and identifies galectin-9 as an immunotherapy target.	name mentioned^*	literature_supp
40789024	Structural insights into VRC01-class bnAb precursors with diverse light chains elicited in the IAVI G001 human vaccine trial.	name mentioned^*	literature_supp
41403245	Explore antibody repertoire in the era of AI.	name mentioned^*	literature_supp
41469389	Defective cell-autonomous signalling and antigenic polyreactivity of B-cell receptors from chronic lymphocytic leukaemia stereotyped subset 1.	name mentioned^*	literature_supp
41606257	Allergen-specific human IgE isolated through an allergen-agnostic pipeline-understanding immune response and allergen recognition.	name mentioned^*	literature_supp
41617721	Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity.	name mentioned^*	literature_supp
41803327	IFN-gene signatures in B cells following influenza A and B virus infection and influenza vaccination.	name mentioned^*	literature_supp
42078068	B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGTGTTGTGACCACATCCTGAGTATGTCAGAAAAC	IMGT	MOUSE-RCXNTW

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGGAAAGGAACTGGATACTTCCTTTTATTATGTCAGTAACTGCAGGTGTCTACTCA	46 + 11 nt	IMGT	MOUSE-LEKDBJ

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/MOUSE-VDRC4BUIE/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

321 nt

CAGGTTCAGCTCCAGCAGTCTGGGCCTGAGCTGGCAAGGCCTTGGGCTTCAGTGAAGATATCCTGCCAGGCTTTCTACACCTTTTCCAGAAGGGTGTACTTTGCCATTAGGGATACCAACTACTGGATGCAGTGGGTAAAACAGAGGCCTGGACAGGGTCTGGAATGGATCGGGGCTATTTATCCTGGAAATGGTGATACTAGTTACAATCAGAAGTTCAAGGGCAAGGCCACATTGACTGCAGACAAATCCTCCAGCACAGCCTACATGCAACTCAGCAGCCTGACATCTGAGGACTCTGCGGTCTATTACTGTGCATGA

Amino-acid sequence (V-REGION)

107 aa

QVQLQQSGPELARPWASVKISCQAFYTFSRRVYFAIRDTNYWMQWVKQRPGQGLEWIGAIYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCA*

Translated here from the nucleotide sequence; no source published a protein for this allele. i

API: JSON · AIRR AlleleDescription · aliases