MOUSE-VH7SBGFGL

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMus musculus LocusIGH TypeV FunctionalTrue Length293 nt

IGHV2-5*01, IGHV2-5D*01: a Mus musculus IGH V allele sequence, 293 nt, functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Mus musculus (NCBITAXON:10090)
Locus / type	IGH / V
Functional i	True
Length	293 nt
Protein UID i	MOUSE-VP-VCR4YP (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

293 nt

CAGGTGCAGCTGAAGCAGTCAGGACCTGGCCTAGTGCAGCCCTCACAGAGCCTGTCCATAACCTGCACAGTCTCTGGTTTCTCATTAACTAGCTATGGTGTACACTGGGTTCGCCAGTCTCCAGGAAAGGGTCTGGAGTGGCTGGGAGTGATATGGAGAGGTGGAAGCACAGACTACAATGCAGCTTTCATGTCCAGACTGAGCATCACCAAGGACAACTCCAAGAGCCAAGTTTTCTTTAAAATGAACAGTCTGCAAGCTGATGACACTGCCATATACTACTGTGCCAAAAA

Amino-acid sequence (V-REGION)

97 aa

QVQLKQSGPGLVQPSQSLSITCTVSGFSLTSYGVHWVRQSPGKGLEWLGVIWRGGSTDYNAAFMSRLSITKDNSKSQVFFKMNSLQADDTAIYYCAK

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (MOUSE-VH7SBGFGL). None is canonical; they are labels, and the UID is the key.

Multiple allele designations. This one sequence is recorded under 2 different allele designations: IGHV2-5*01, IGHV2-5D*01. These are identical normalized nucleotide sequences with different attributed names.

Name	Scheme	Source(s)
IGHV2-5*01	IMGT	IMGT
IGHV2-5D*01	IMGT	IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

Name	Kind	Source(s)
AC090887.3	NCBI accession	ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:AC090887 GenBank: GENBANK:BK063713 IMGT: IGHV2-5*01

Literature references 26 total · 26 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
22806814	Degenerate primer design to clone the human repertoire of immunoglobulin heavy chain variable regions.	name mentioned^*	literature_supp
29545810	Repertoire Analysis of Antibody CDR-H3 Loops Suggests Affinity Maturation Does Not Typically Result in Rigidification.	name mentioned^*	literature_supp
29558968	BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data.	name mentioned^*	literature_supp
31839985	More than one antibody of individual B cells revealed by single-cell immune profiling.	name mentioned^*	literature_supp
31974198	Genomic arrays identify high-risk chronic lymphocytic leukemia with genomic complexity: a multi-center study.	name mentioned^*	literature_supp
32365177	Polymorphisms in human immunoglobulin heavy chain variable genes and their upstream regions.	name mentioned^*	literature_supp
32425948	AID Overlapping and Polη Hotspots Are Key Features of Evolutionary Variation Within the Human Antibody Heavy Chain (IGHV) Genes.	name mentioned^*	literature_supp
32636395	IgCaller for reconstructing immunoglobulin gene rearrangements and oncogenic translocations from whole-genome sequencing in lymphoid neoplasms.	name mentioned^*	literature_supp
33843586	Distinct clonal evolution of B-cells in HIV controllers with neutralizing antibody breadth.	name mentioned^*	literature_supp
34040612	Characterization of DNA G-Quadruplex Structures in Human Immunoglobulin Heavy Variable (IGHV) Genes.	name mentioned^*	literature_supp
34671351	Computational Inference, Validation, and Analysis of 5'UTR-Leader Sequences of Alleles of Immunoglobulin Heavy Chain Variable Genes.	name mentioned^*	literature_supp
35720344	A BALB/c IGHV Reference Set, Defined by Haplotype Analysis of Long-Read VDJ-C Sequences From F1 (BALB/c x C57BL/6) Mice.	name mentioned^*	literature_supp
35837088	Characterizing Features of Human Circulating B Cells Carrying CLL-Like Stereotyped Immunoglobulin Rearrangements.	name mentioned^*	literature_supp
36473496	Antibody feedback regulates immune memory after SARS-CoV-2 mRNA vaccination.	name mentioned^*	literature_supp
37533642	TRAPnSeq allows high-throughput profiling of antigen-specific antibody-secreting cells.	name mentioned^*	literature_supp
38435425	Analysis of immunoglobulin/T-cell receptor repertoires by high-throughput RNA sequencing reveals a continuous dynamic of positive clonal selection in follicular lymphoma.	name mentioned^*	literature_supp
39698082	Comprehensive method for producing high-affinity mouse monoclonal antibodies of various isotypes against (4-hydroxy-3-nitrophenyl)acetyl (NP) hapten.	name mentioned^*	literature_supp
39840032	An allelic atlas of immunoglobulin heavy chain variable regions reveals antibody binding epitope preference resilient to SARS-CoV-2 mutation escape.	name mentioned^*	literature_supp
39873992	Association of Specific Gene Mutations with Immunoglobulin Heavy-Chain Variable Region and Chromosomal Alterations in Chronic Lymphocytic Leukemia Patients in India.	name mentioned^*	literature_supp
40664667	High-resolution mapping of single cells in spatial context.	name mentioned^*	literature_supp
41403245	Explore antibody repertoire in the era of AI.	name mentioned^*	literature_supp
41410768	Convergent mutation trajectories convert functional self-tolerance in IGHV4-34 B cells to genetic tolerance encoded in the antibody.	name mentioned^*	literature_supp
41606257	Allergen-specific human IgE isolated through an allergen-agnostic pipeline-understanding immune response and allergen recognition.	name mentioned^*	literature_supp
41617721	Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity.	name mentioned^*	literature_supp
41803327	IFN-gene signatures in B cells following influenza A and B virus infection and influenza vaccination.	name mentioned^*	literature_supp
42078068	B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGTGAGGGAAGTCCATTATGAACCTGAACAAAAATT	IMGT	MOUSE-RTMA23

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGGCTGTCCTGGTGCTGCTCCTCTGCCTGGTGACATTCCCAAGCTGTGTCCTGTCC	46 + 11 nt	IMGT	MOUSE-L7RY4N
ATGGCTGTCCTGGTGCTGCTCCTCTGCCTGGTGACATTCCCAAGCTGTGTCCTATCC	46 + 11 nt	IMGT	MOUSE-LPFN5H

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/MOUSE-VH7SBGFGL/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases