MOUSE-VLVYQVPRP

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMus musculus LocusIGH TypeV FunctionalNone Length321 nt

Earlier records of this allele i

IMGT has published this allele name over more than one sequence extent. Earlier sequence extents are deferred from default search results but remain resolvable, so a paper that cited one still leads here.

Record	Name	Length	Relation to this record	IMGT releases
MOUSE-VMKOEKQFO	*IGHV1-201**	297 nt	contained in this record	2013-01-20–2015-03-19
MOUSE-VCHVNDGRI	*IGHV1-201**	294 nt	contained in this record	2016-12-19–2022-01-17

Species	Mus musculus (NCBITAXON:10090)
Locus / type	IGH / V
Functional i	None
Length	321 nt
Protein UID i	MOUSE-VP-4C3Z7N (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (MOUSE-VLVYQVPRP). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV1-2*01	IMGT	IMGT

External records i

IMGT: IGHV1-2*01

Literature references 26 total · 1 sequence-in-paper · 25 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
35720344	A BALB/c IGHV Reference Set, Defined by Haplotype Analysis of Long-Read VDJ-C Sequences From F1 (BALB/c x C57BL/6) Mice.	sequence in paper	literature_supp
20875155	Clustering-based identification of clonally-related immunoglobulin gene sequence sets.	name mentioned^*	literature_supp
24600447	Immunoglobulin and T Cell Receptor Genes: IMGT(®) and the Birth and Rise of Immunoinformatics.	name mentioned^*	literature_supp
25521638	Immunoglobulins: 25 years of immunoinformatics and IMGT-ONTOLOGY.	name mentioned^*	literature_supp
27074145	Maximum-Entropy Models of Sequenced Immune Repertoires Predict Antigen-Antibody Affinity.	name mentioned^*	literature_supp
29283291	Structural insights into humanization of anti-tissue factor antibody 10H10.	name mentioned^*	literature_supp
29558968	BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data.	name mentioned^*	literature_supp
31839985	More than one antibody of individual B cells revealed by single-cell immune profiling.	name mentioned^*	literature_supp
31873728	Benchmarking immunoinformatic tools for the analysis of antibody repertoire sequences.	name mentioned^*	literature_supp
32636395	IgCaller for reconstructing immunoglobulin gene rearrangements and oncogenic translocations from whole-genome sequencing in lymphoid neoplasms.	name mentioned^*	literature_supp
32878258	Immunoglobulins or Antibodies: IMGT® Bridging Genes, Structures and Functions.	name mentioned^*	literature_supp
33717051	Poorly Expressed Alleles of Several Human Immunoglobulin Heavy Chain Variable Genes are Common in the Human Population.	name mentioned^*	literature_supp
35592326	Pandemic, Epidemic, Endemic: B Cell Repertoire Analysis Reveals Unique Anti-Viral Responses to SARS-CoV-2, Ebola and Respiratory Syncytial Virus.	name mentioned^*	literature_supp
36328595	Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing.	name mentioned^*	literature_supp
36604758	Bacteroides-derived isovaleric acid enhances mucosal immunity by facilitating intestinal IgA response in broilers.	name mentioned^*	literature_supp
37640732	Engaging an HIV vaccine target through the acquisition of low B cell affinity.	name mentioned^*	literature_supp
38567069	Diversification of immunoglobulin genes by gene conversion in the domestic chicken (Gallus gallus domesticus).	name mentioned^*	literature_supp
38961347	Systematic characterization of immunoglobulin loci and deep sequencing of the expressed repertoire in the Atlantic cod (Gadus morhua).	name mentioned^*	literature_supp
39840032	An allelic atlas of immunoglobulin heavy chain variable regions reveals antibody binding epitope preference resilient to SARS-CoV-2 mutation escape.	name mentioned^*	literature_supp
40066131	Characterization of Immunoglobulin Heavy Locus Rearrangements in Molecular Subtypes of Childhood B-Cell Precursor Acute Lymphoblastic Leukemia.	name mentioned^*	literature_supp
40664667	High-resolution mapping of single cells in spatial context.	name mentioned^*	literature_supp
41021799	Molecular divergence and convergence of mammalian antibody responses to the influenza virus hemagglutinin stem.	name mentioned^*	literature_supp
41617721	Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity.	name mentioned^*	literature_supp
41941497	Pigs lacking Natural Killer T cells have altered cellular responses to influenza.	name mentioned^*	literature_supp
42041394	IMGT® Nomenclature of Immunoglobulins (IG) or Antibodies and T Cell Receptors (TR): A Common Language for Immunoinformatics and Artificial Intelligence (AI).	name mentioned^*	literature_supp
42078068	B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGTGTTGTGACCACATCCTGAGTATGTCAGAAAAC	IMGT	MOUSE-RCXNTW

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGGAATGGAACTGGATACTTCCTTTTATTATGTCAGTAACTGCAGGTGTCTACTCA	46 + 11 nt	IMGT	MOUSE-LYJ5B3

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/MOUSE-VLVYQVPRP/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

321 nt

CAGGTTCAGCTCCAGCAGTCTGGGCCTGAGCTGGCAAGGCCTTGGGCTTCAGTGAAGATATCCTGCCAGGCTTTCTACACCTTTTCCAGAAGGGTGCACTTTGCCATTAGGGATACCAACTACTGGATGCAGTGGGTAAAACAGAGGCCTGGACAGGGTCTGGAATGGATCGGGGCTATTTATCCTGGAAATGGTGATACTAGTTACAATCAGAAGTTCAAGGGCAAGGCCACATTGACTGCAGACAAATCCTCCAGCACAGCCTACATGCAACTCAGCAGCCTGACATCTGAGGACTCTGCGGTCTATTACTGTGCATGA

Amino-acid sequence (V-REGION)

107 aa

QVQLQQSGPELARPWASVKISCQAFYTFSRRVHFAIRDTNYWMQWVKQRPGQGLEWIGAIYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCA*

Translated here from the nucleotide sequence; no source published a protein for this allele. i

API: JSON · AIRR AlleleDescription · aliases