MOUSE-VSLKHAWVC

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMus musculus LocusIGH TypeV FunctionalFalse Length296 nt

IGHV3-7*03: a Mus musculus IGH V allele sequence, 296 nt, non-functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Mus musculus (NCBITAXON:10090)
Locus / type	IGH / V
Functional i	False
Length	296 nt
Protein UID i	MOUSE-VP-ERQ5BM (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

296 nt

GAGGTACAGCTCCAGGAGTCAGGACCTGACCTGGTGAAAACTTCTCAGTCACTGTCCTTCACCTGCTCTGTCACTGGCTACTCCATCACCAGTGGTTATGACTGGAACTGCATCTGGCAGTTTCCAGGAAACAAACTGTAGTGTATGAGGTACATACACAAGAGTGGTAGCACTAACTACAACCCATCTCTCAAAAGTCAAGTCTCCATCACTCGAGACACTTCCAAGAACCAGTACTACCTGCAGTTGAATTTTGTGACTACTGAGGACACAGCCAGATATTACTGTGCAAACGA

Amino-acid sequence (V-REGION)

98 aa

EVQLQESGPDLVKTSQSLSFTCSVTGYSITSGYDWNCIWQFPGNKL*CMRYIHKSGSTNYNPSLKSQVSITRDTSKNQYYLQLNFVTTEDTARYYCAN

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (MOUSE-VSLKHAWVC). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV3-7*03	IMGT	IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

Name	Kind	Source(s)
BK063714.1	NCBI accession	ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:BK063714 GenBank: GENBANK:BK063714.1 IMGT: IGHV3-7*03

Literature references 33 total · 1 verified · 32 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
34875068		verified	ncbi_nucleotide
26848863	Clonal relationships in recurrent B-cell lymphomas.	name mentioned^*	literature_supp
29180996	Antibody Heavy Chain Variable Domains of Different Germline Gene Origins Diversify through Different Paths.	name mentioned^*	literature_supp
29545810	Repertoire Analysis of Antibody CDR-H3 Loops Suggests Affinity Maturation Does Not Typically Result in Rigidification.	name mentioned^*	literature_supp
29558968	BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data.	name mentioned^*	literature_supp
29662487	Acquisition of N-Glycosylation Sites in Immunoglobulin Heavy Chain Genes During Local Expansion in Parotid Salivary Glands of Primary Sjögren Patients.	name mentioned^*	literature_supp
31839985	More than one antibody of individual B cells revealed by single-cell immune profiling.	name mentioned^*	literature_supp
31974198	Genomic arrays identify high-risk chronic lymphocytic leukemia with genomic complexity: a multi-center study.	name mentioned^*	literature_supp
32636395	IgCaller for reconstructing immunoglobulin gene rearrangements and oncogenic translocations from whole-genome sequencing in lymphoid neoplasms.	name mentioned^*	literature_supp
33485405	Enhancement versus neutralization by SARS-CoV-2 antibodies from a convalescent donor associates with distinct epitopes on the RBD.	name mentioned^*	literature_supp
33843586	Distinct clonal evolution of B-cells in HIV controllers with neutralizing antibody breadth.	name mentioned^*	literature_supp
34126625	Naturally enhanced neutralizing breadth against SARS-CoV-2 one year after infection.	name mentioned^*	literature_supp
34242577	In vitro and in vivo functions of SARS-CoV-2 infection-enhancing and neutralizing antibodies.	name mentioned^*	literature_supp
34614412	mRNA vaccination of naive and COVID-19-recovered individuals elicits potent memory B cells that recognize SARS-CoV-2 variants.	name mentioned^*	literature_supp
34765543	The Hydropathy Index of the HCDR3 Region of the B-Cell Receptor Identifies Two Subgroups of IGHV-Mutated Chronic Lymphocytic Leukemia Patients With Distinct Outcome.	name mentioned^*	literature_supp
34785098	Landscapes and dynamic diversifications of B-cell receptor repertoires in COVID-19 patients.	name mentioned^*	literature_supp
35447092	Analysis of memory B cells identifies conserved neutralizing epitopes on the N-terminal domain of variant SARS-Cov-2 spike proteins.	name mentioned^*	literature_supp
35776090	Antibody evolution to SARS-CoV-2 after single-dose Ad26.COV2.S vaccine in humans.	name mentioned^*	literature_supp
35837088	Characterizing Features of Human Circulating B Cells Carrying CLL-Like Stereotyped Immunoglobulin Rearrangements.	name mentioned^*	literature_supp
36149398	Memory B cell responses to Omicron subvariants after SARS-CoV-2 mRNA breakthrough infection in humans.	name mentioned^*	literature_supp
36328595	Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing.	name mentioned^*	literature_supp
36351924	Single-cell profiling reveals a memory B cell-like subtype of follicular lymphoma with increased transformation risk.	name mentioned^*	literature_supp
36827454	Modeling and predicting the overlap of B- and T-cell receptor repertoires in healthy and SARS-CoV-2 infected individuals.	name mentioned^*	literature_supp
36874132	Characterization of clonal immunoglobulin heavy V-D-J gene rearrangements in Chinese patients with chronic lymphocytic leukemia: Clinical features and molecular profiles.	name mentioned^*	literature_supp
37368240	Memory B cell development elicited by mRNA booster vaccinations in the elderly.	name mentioned^*	literature_supp
38435425	Analysis of immunoglobulin/T-cell receptor repertoires by high-throughput RNA sequencing reveals a continuous dynamic of positive clonal selection in follicular lymphoma.	name mentioned^*	literature_supp
40066131	Characterization of Immunoglobulin Heavy Locus Rearrangements in Molecular Subtypes of Childhood B-Cell Precursor Acute Lymphoblastic Leukemia.	name mentioned^*	literature_supp
40433552	Antigen selection reflected in the subclonal architecture of the B-cell receptor immunoglobulin gene repertoire in splenic marginal zone lymphoma.	name mentioned^*	literature_supp
40664667	High-resolution mapping of single cells in spatial context.	name mentioned^*	literature_supp
41617721	Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity.	name mentioned^*	literature_supp
41803327	IFN-gene signatures in B cells following influenza A and B virus infection and influenza vaccination.	name mentioned^*	literature_supp
42078068	B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies.	name mentioned^*	literature_supp
42256548	Genomic heterogeneity in primary cutaneous follicular center lymphomas reveals different clinicopathological subgroups.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGTGTGGTGTCTTCAGTGTGAGCCCAGAAATAAACC	IMGT	MOUSE-R2NR4J

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGAGAGTGTTGAGTCTTGTGTACCTGTTGATAGGTGTTCCTGGTATCCTATCC	43 + 11 nt	IMGT	MOUSE-LBUQNN

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/MOUSE-VSLKHAWVC/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases