MOUSE-VXXPXZC2R

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMus musculus LocusIGH TypeV FunctionalTrue Length294 nt

IGHV1-69-2*01, IGHV1-69-2D*01: a Mus musculus IGH V allele sequence, 294 nt, functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Mus musculus (NCBITAXON:10090)
Locus / type	IGH / V
Functional i	True
Length	294 nt
Protein UID i	MOUSE-VP-PMKTSR (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

294 nt

CAGGTCCAGCTGCAGCAGTCTGGAGCTGAGCTGGTAAGGCCTGGGACTTCAGTGAAGGTGTCCTGCAAGGCTTCTGGATACGCCTTCACTAATTACTTGATAGAGTGGGTAAAGCAGAGGCCTGGACAGGGCCTTGAGTGGATTGGAGTGATTAATCCTGGAAGTGGTGGTACTAACTACAATGAGAAGTTCAAGGGCAAGGCAACACTGACTGCAGACAAATCCTCCAGCACTGCCTACATGCAGCTCAGCAGCCTGACATCTGATGACTCTGCGGTCTATTTCTGTGCAAGA

Amino-acid sequence (V-REGION)

98 aa

QVQLQQSGAELVRPGTSVKVSCKASGYAFTNYLIEWVKQRPGQGLEWIGVINPGSGGTNYNEKFKGKATLTADKSSSTAYMQLSSLTSDDSAVYFCAR

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (MOUSE-VXXPXZC2R). None is canonical; they are labels, and the UID is the key.

Multiple allele designations. This one sequence is recorded under 2 different allele designations: IGHV1-69-2*01, IGHV1-69-2D*01. These are identical normalized nucleotide sequences with different attributed names.

Name	Scheme	Source(s)
IGHV1-69-2*01	IMGT	IMGT
IGHV1-69-2D*01	IMGT	IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

Name	Kind	Source(s)
BK063713.1	NCBI accession	ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:BK063713 GenBank: GENBANK:BK063713.1 IMGT: IGHV1-69-2*01

Literature references 19 total · 1 verified · 18 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
34875068		verified	ncbi_nucleotide
26440796	Development of Human-Like scFv-Fc Neutralizing Botulinum Neurotoxin E.	name mentioned^*	literature_supp
29545810	Repertoire Analysis of Antibody CDR-H3 Loops Suggests Affinity Maturation Does Not Typically Result in Rigidification.	name mentioned^*	literature_supp
29558968	BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data.	name mentioned^*	literature_supp
30697215	VH1-69 Utilizing Antibodies Are Capable of Mediating Non-neutralizing Fc-Mediated Effector Functions Against the Transmitted/Founder gp120.	name mentioned^*	literature_supp
32156260	Tracing CLL-biased stereotyped immunoglobulin gene rearrangements in normal B cell subsets using a high-throughput immunogenetic approach.	name mentioned^*	literature_supp
32636395	IgCaller for reconstructing immunoglobulin gene rearrangements and oncogenic translocations from whole-genome sequencing in lymphoid neoplasms.	name mentioned^*	literature_supp
33048842	Antimalarial antibody repertoire defined by plasma IG proteomics and single B cell IG sequencing.	name mentioned^*	literature_supp
33843586	Distinct clonal evolution of B-cells in HIV controllers with neutralizing antibody breadth.	name mentioned^*	literature_supp
34126625	Naturally enhanced neutralizing breadth against SARS-CoV-2 one year after infection.	name mentioned^*	literature_supp
34242577	In vitro and in vivo functions of SARS-CoV-2 infection-enhancing and neutralizing antibodies.	name mentioned^*	literature_supp
35592326	Pandemic, Epidemic, Endemic: B Cell Repertoire Analysis Reveals Unique Anti-Viral Responses to SARS-CoV-2, Ebola and Respiratory Syncytial Virus.	name mentioned^*	literature_supp
35837088	Characterizing Features of Human Circulating B Cells Carrying CLL-Like Stereotyped Immunoglobulin Rearrangements.	name mentioned^*	literature_supp
36328595	Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing.	name mentioned^*	literature_supp
36827454	Modeling and predicting the overlap of B- and T-cell receptor repertoires in healthy and SARS-CoV-2 infected individuals.	name mentioned^*	literature_supp
39840032	An allelic atlas of immunoglobulin heavy chain variable regions reveals antibody binding epitope preference resilient to SARS-CoV-2 mutation escape.	name mentioned^*	literature_supp
40066131	Characterization of Immunoglobulin Heavy Locus Rearrangements in Molecular Subtypes of Childhood B-Cell Precursor Acute Lymphoblastic Leukemia.	name mentioned^*	literature_supp
41617721	Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity.	name mentioned^*	literature_supp
42078068	B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGTGCTGTAACCACATCCAGAGTGTGTCTGAAACCC	IMGT	MOUSE-RHBFHN

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGGAATGGAGCGGAGTCTTTATCTTTCTCCTGTCAGTAACTGCAGGTGTTCACTCC	46 + 11 nt	IMGT	MOUSE-LKTOXF

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/MOUSE-VXXPXZC2R/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases