AIRBabel immunoglobulin and T-cell receptor allele sequences · leaders · RSSs

← back to search

NMOLERAT-VEIHLJCZA

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesHeterocephalus glaber LocusTRA TypeV FunctionalNone Length201 nt

TRAV13-1*01, TRAV13-1*02: a Heterocephalus glaber TRA V allele sequence, 201 nt, not recorded. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Earlier records of this allele i

IMGT has published this allele name over more than one sequence extent. Earlier sequence extents are deferred from default search results but remain resolvable, so a paper that cited one still leads here.

RecordNameLengthRelation to this recordIMGT releases
NMOLERAT-VIT3FNTFV TRAV13-1*01 234 nt contains this record 2021-12-27–2024-01-07
NMOLERAT-VJYQSBQLU TRAV13-1*02 234 nt contains this record 2021-12-27–2024-01-07
SpeciesHeterocephalus glaber (NCBITAXON:10181)
Locus / typeTRA / V
Functional iNone
Length201 nt
Protein UID iNMOLERAT-VP-3Q4XON (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

201 nt
AGAGAGCAAGTGGGGCAGCATCCTTCTACCTTGAGAGTCCAGGAGGGAGACAGCTCTGTTATCAACTGTACTTATTCAGACAGTGCTTCATCCTACTTCCCTTGGTATAAGCAGGAACCTGGAAAGGGTCCTCAGCTTATTATCAACACTCGTTCAAATATGGACAGAGAGAAAAATCAAAGACTCATCGTTTCATTCAAC

Amino-acid sequence (V-REGION)

67 aa
REQVGQHPSTLRVQEGDSSVINCTYSDSASSYFPWYKQEPGKGPQLIINTRSNMDREKNQRLIVSFN

Translated here from the nucleotide sequence; no source published a protein for this allele. i

Name history i: re-cut from TRAV13-1*01 (234 nt); re-cut from TRAV13-1*02 (234 nt);

Allele names i

Every name below denotes this exact sequence (NMOLERAT-VEIHLJCZA). None is canonical; they are labels, and the UID is the key.

Multiple allele designations. This one sequence is recorded under 2 different allele designations: TRAV13-1*01, TRAV13-1*02. These are identical normalized nucleotide sequences with different attributed names.

NameSchemeSource(s)
TRAV13-1*01 IMGT IMGT
TRAV13-1*02 IMGT IMGT

External records i

IMGT: TRAV13-1*01

Literature references 26 total · 26 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMIDTitleEvidenceSource
22792299 Unbiased analysis of TCRα/β chains at the single-cell level in human CD8+ T-cell subsets. name mentioned* literature_supp
27460926 Single-cell TCRseq: paired recovery of entire T-cell alpha and beta chain transcripts in T-cell receptors from single-cell RNAseq. name mentioned* literature_supp
30152754 Human T cell receptor occurrence patterns encode immune history, genetic background, and receptor specificity. name mentioned* literature_supp
31237075 Comparative analysis of CDR3 regions in paired human αβ CD8 T cells. name mentioned* literature_supp
32668259 CD4+ T Cells Recognize Conserved Influenza A Epitopes through Shared Patterns of V-Gene Usage and Complementary Biochemical Features. name mentioned* literature_supp
32868763 Single-cell RNA sequencing identifies shared differentiation paths of mouse thymic innate T cells. name mentioned* literature_supp
36408799 SARS-CoV-2-specific CD4+ and CD8+ T cell responses can originate from cross-reactive CMV-specific T cells. name mentioned* literature_supp
36603583 Improved predictions of antigen presentation and TCR recognition with MixMHCpred2.2 and PRIME2.0 reveal potent SARS-CoV-2 CD8+ T-cell epitopes. name mentioned* literature_supp
36923729 Cross-reactivity influences changes in human influenza A virus and Epstein Barr virus specific CD8 memory T cell receptor alpha and beta repertoires between young and old. name mentioned* literature_supp
37287989 Targeting KRASG12V mutations with HLA class II-restricted TCR for the immunotherapy in solid tumors. name mentioned* literature_supp
38615042 Deep learning predictions of TCR-epitope interactions reveal epitope-specific chains in dual alpha T cells. name mentioned* literature_supp
38658646 De novo identification of CD4+ T cell epitopes. name mentioned* literature_supp
38762584 Invariant γδTCR natural killer-like effector T cells in the naked mole-rat. name mentioned* literature_supp
38871688 Germline-like TCR-α chains shared between autoreactive T cells in blood and pancreas. name mentioned* literature_supp
38954022 Identification and validation of tumor-specific T cell receptors from tumor infiltrating lymphocytes using tumor organoid co-cultures. name mentioned* literature_supp
39421738 scRNA+TCR-seq reveals the pivotal role of dual receptor T lymphocytes in the pathogenesis of Kawasaki disease and during IVIG treatment. name mentioned* literature_supp
39507623 Development and characterization of human T-cell receptor (TCR) alpha and beta clones' library as biological standards and resources for TCR sequencing and engineering. name mentioned* literature_supp
40165973 T-cell receptors identified by a personalized antigen-agnostic screening approach target shared neoantigen KRAS Q61H. name mentioned* literature_supp
40664667 High-resolution mapping of single cells in spatial context. name mentioned* literature_supp
40866291 Spatial TCR clonality and clonal expansion in the in situ microenvironment of non-small cell lung cancer. name mentioned* literature_supp
40877317 Molecular basis of potent antiviral HLA-C-restricted CD8+ T cell response to an immunodominant SARS-CoV-2 nucleocapsid epitope. name mentioned* literature_supp
41306962 Promiscuous class II-binding SARS-CoV-2-nuc derived vaccine-peptide induced extensive conventional, innate and unconventional T cell responses. name mentioned* literature_supp
41407706 Resistance potential of the HLA-A2-restricted immunodominant SARS-CoV-2-specific CD8+ T cell receptor repertoire to antigenic drift. name mentioned* literature_supp
41424382 Identification of Sjögren's disease-associated T cell receptor motifs through deep sequencing. name mentioned* literature_supp
41766885 Correction: Promiscuous class II-binding SARS-CoV-2-nuc derived vaccine-peptide induced extensive conventional, innate and unconventional T cell responses. name mentioned* literature_supp
42125653 N-terminal pyroglutamylation of an HLA-A24-restricted immunodominant epitope enhances SARS-CoV-2-specific T-cell responses. name mentioned* literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)SplitSourceLeader UID
ATGAAGACATCCACACAGGCTTTATTCACATTCTTGTACCTGCAGCTGGACTGGGGCTGA 52 + 8 nt IMGT NMOLERAT-LWHPLF

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/NMOLERAT-VEIHLJCZA/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases