NMOLERAT-VTSB5N226

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesHeterocephalus glaber LocusTRB TypeV FunctionalNone Length278 nt

TRBV15*02: a Heterocephalus glaber TRB V allele sequence, 278 nt, not recorded. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Heterocephalus glaber (NCBITAXON:10181)
Locus / type	TRB / V
Functional i	None
Length	278 nt
Protein UID i	NMOLERAT-VP-AKKYB2 (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

278 nt

CTTCTGCAGGTCCTGTGGGTGCTGTGGTCATGAAGATAGCTTACCAAGCTGGGAAAACCAGTGACCCTGAGTCAGTATCTGAATCATTATCCCATGTACTGGTACCAAAAGAAGCCCAACCAAGGACCAAAGTTGCTTTTTTACTACTCTTAAAGACTTGAACAAGACAAAAGACACTTCAGATAACTTCCAGTCCAGATGGCCTAACACTTCTCCCTTGACATCTGCTTGCCTGGCCTGGAGGACTCAGGGGTGTACCTGTGTTCCAGCAGCAGAGA

Amino-acid sequence (V-REGION)

92 aa

LLQVLWVLWS*R*LTKLGKPVTLSQYLNHYPMYWYQKKPNQGPKLLFYYS*RLEQDKRHFR*LPVQMA*HFSLDICLPGLEDSGVYLCSSSR

Translated here from the nucleotide sequence; no source published a protein for this allele. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (NMOLERAT-VTSB5N226). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
TRBV15*02	IMGT	IMGT

External records i

IMGT: TRBV15*02

Literature references 14 total · 14 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
22792299	Unbiased analysis of TCRα/β chains at the single-cell level in human CD8+ T-cell subsets.	name mentioned^*	literature_supp
23995877	IMGT/HighV QUEST paradigm for T cell receptor IMGT clonotype diversity and next generation repertoire immunoprofiling.	name mentioned^*	literature_supp
26962778	High Throughput Sequencing of T Cell Antigen Receptors Reveals a Conserved TCR Repertoire.	name mentioned^*	literature_supp
30541895	Autoimmunity to hypocretin and molecular mimicry to flu in type 1 narcolepsy.	name mentioned^*	literature_supp
31237075	Comparative analysis of CDR3 regions in paired human αβ CD8 T cells.	name mentioned^*	literature_supp
36408799	SARS-CoV-2-specific CD4+ and CD8+ T cell responses can originate from cross-reactive CMV-specific T cells.	name mentioned^*	literature_supp
38615042	Deep learning predictions of TCR-epitope interactions reveal epitope-specific chains in dual alpha T cells.	name mentioned^*	literature_supp
38871688	Germline-like TCR-α chains shared between autoreactive T cells in blood and pancreas.	name mentioned^*	literature_supp
40664667	High-resolution mapping of single cells in spatial context.	name mentioned^*	literature_supp
40877317	Molecular basis of potent antiviral HLA-C-restricted CD8+ T cell response to an immunodominant SARS-CoV-2 nucleocapsid epitope.	name mentioned^*	literature_supp
41306962	Promiscuous class II-binding SARS-CoV-2-nuc derived vaccine-peptide induced extensive conventional, innate and unconventional T cell responses.	name mentioned^*	literature_supp
41407706	Resistance potential of the HLA-A2-restricted immunodominant SARS-CoV-2-specific CD8+ T cell receptor repertoire to antigenic drift.	name mentioned^*	literature_supp
41766885	Correction: Promiscuous class II-binding SARS-CoV-2-nuc derived vaccine-peptide induced extensive conventional, innate and unconventional T cell responses.	name mentioned^*	literature_supp
42125653	N-terminal pyroglutamylation of an HLA-A24-restricted immunodominant epitope enhances SARS-CoV-2-specific T-cell responses.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGAGCTGCAGTGGTACCTGCTCTCTGCTCAGACCCA	IMGT	NMOLERAT-R5GMCC

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/NMOLERAT-VTSB5N226/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases