ORANGBOR-VGOHYR7C2

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesPongo pygmaeus LocusTRD TypeV FunctionalTrue Length287 nt

TRDV1*01: a Pongo pygmaeus TRD V allele sequence, 287 nt, functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Pongo pygmaeus (NCBITAXON:9600)
Locus / type	TRD / V
Functional i	True
Length	287 nt
Protein UID i	ORANGBOR-VP-CRXRJW (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

287 nt

GCCCAGCAGGTTACTCAAGCCCAGTCATCAGTATCCATGCCAGTGGGGAAAGCAGTCACCCTGAACTGCCGGTATGAAACAAGTCGGTGGTCATATTATATTTTTTGGTACAAGCAACCTCCCAGCAAAGAGATGATTTTCCTTATTCGCCAGGGTTCTGGAGAACAGAATGCAAAAAATGGTCGCTATTCTGTCACATTCAAGGAAGCAGCGAAATCCATCTCCTTAACCATTTCAGCCTTACAGCTAGAACATTCAGCAAAGTACTTCTGTGCTCTTTGGGAACT

Amino-acid sequence (V-REGION)

95 aa

AQQVTQAQSSVSMPVGKAVTLNCRYETSRWSYYIFWYKQPPSKEMIFLIRQGSGEQNAKNGRYSVTFKEAAKSISLTISALQLEHSAKYFCALWE

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (ORANGBOR-VGOHYR7C2). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
TRDV1*01	IMGT	IMGT

External records i

IMGT: TRDV1*01

Literature references 19 total · 1 sequence-in-paper · 18 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
40205052	Complete sequencing of ape genomes.	sequence in paper	literature_supp
22792299	Unbiased analysis of TCRα/β chains at the single-cell level in human CD8+ T-cell subsets.	name mentioned^*	literature_supp
23957733	Fine mapping of V(D)J recombinase mediated rearrangements in human lymphoid malignancies.	name mentioned^*	literature_supp
27528257	Genomic and expression analyses of Tursiops truncatus T cell receptor gamma (TRG) and alpha/delta (TRA/TRD) loci reveal a similar basic public γδ repertoire in dolphin and human.	name mentioned^*	literature_supp
31237075	Comparative analysis of CDR3 regions in paired human αβ CD8 T cells.	name mentioned^*	literature_supp
32868763	Single-cell RNA sequencing identifies shared differentiation paths of mouse thymic innate T cells.	name mentioned^*	literature_supp
33374673	TCR Recognition of Peptide-MHC-I: Rule Makers and Breakers.	name mentioned^*	literature_supp
34312491	Butyrophilin-like 2 regulates site-specific adaptations of intestinal γδ intraepithelial lymphocytes.	name mentioned^*	literature_supp
35432299	Durable Expansion of TCR-δ Meta-Clonotypes After BCG Revaccination in Humans.	name mentioned^*	literature_supp
35436998	pmTR database: population matched (pm) germline allelic variants of T-cell receptor (TR) loci.	name mentioned^*	literature_supp
36408799	SARS-CoV-2-specific CD4+ and CD8+ T cell responses can originate from cross-reactive CMV-specific T cells.	name mentioned^*	literature_supp
37056780	Impact of BCG vaccination on the repertoire of human γδ T cell receptors.	name mentioned^*	literature_supp
38762584	Invariant γδTCR natural killer-like effector T cells in the naked mole-rat.	name mentioned^*	literature_supp
40244697	Single-cell transcriptional analysis reveals allergen-specific signatures in human γδ T cells.	name mentioned^*	literature_supp
40664667	High-resolution mapping of single cells in spatial context.	name mentioned^*	literature_supp
40866291	Spatial TCR clonality and clonal expansion in the in situ microenvironment of non-small cell lung cancer.	name mentioned^*	literature_supp
41021035	The protective role of γδ T cells in endometrial cancer.	name mentioned^*	literature_supp
41306962	Promiscuous class II-binding SARS-CoV-2-nuc derived vaccine-peptide induced extensive conventional, innate and unconventional T cell responses.	name mentioned^*	literature_supp
41898550	Single-Cell Multi-Tissue T Cell Clonal Dynamics Reveal Distinct Immune Coercion Landscapes in MSI and MSS Colorectal Cancer.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGTGTTTGAAGTGATAGTAAAAGCAAAACAAAAACC	IMGT	ORANGBOR-RBST65

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGCTGTTCTCCAGCCTGCTGTGCGTATTTGTGGCCTTCAGCTACTCTGGATCCAGTGTG	49 + 11 nt	IMGT	ORANGBOR-LIR562

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/ORANGBOR-VGOHYR7C2/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases