ORANGSUM-VI3L47AEX

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesPongo abelii LocusIGH TypeV FunctionalNone Length304 nt

IGHV3-65*03: a Pongo abelii IGH V allele sequence, 304 nt, not recorded. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Pongo abelii (NCBITAXON:9601)
Locus / type	IGH / V
Functional i	None
Length	304 nt
Protein UID i	ORANGSUM-VP-QGIFN6 (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

304 nt

GAGGTGCAGCTGGTAGAGTCTGGGGGAGACTTGGTACAGCTGTGGCGGGGTTGGGGGTGTCCTGAGACTTTCCTGTGCAGCCTGTGGATTCACCTTGAGAGGCAATGACATGAACTGGGTCCACCGGGCTTCAAGAAAGGGGCTGGAGTGAGTCTCATACATTAGTGCTAGTGGTGGTAGCCTATACTATGCAGACACTGAAGGGTAGATTCGCCATCTGTAGAGACAATGGCAAGAGCATGCTGTACTTGCAAATGCACAGTCTGAGAGATGAGGACTCGGCCGTGTGAGAGACATGGTGAGG

Amino-acid sequence (V-REGION)

101 aa

EVQLVESGGDLVQLWRGWGCPETFLCSLWIHLERQ*HELGPPGFKKGAGVSLIH*C*WW*PILCRH*RVDSPSVETMARACCTCKCTV*EMRTRPCERHGE

Translated here from the nucleotide sequence; no source published a protein for this allele. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (ORANGSUM-VI3L47AEX). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV3-65*03	IMGT	IMGT

External records i

IMGT: IGHV3-65*03

Literature references 1 total · 1 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
36328595	Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGTTGTTTGGGCTGAGCTGGGCTTTCCTTGTTACTATTTTAAGAGGTGTGCAGTAT	46 + 11 nt	IMGT	ORANGSUM-LO222M

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/ORANGSUM-VI3L47AEX/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases