ORANGSUM-VKOZSEJ6U

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesPongo abelii LocusTRB TypeV FunctionalNone Length287 nt

TRBV4-2*01: a Pongo abelii TRB V allele sequence, 287 nt, not recorded. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Pongo abelii (NCBITAXON:9601)
Locus / type	TRB / V
Functional i	None
Length	287 nt
Protein UID i	ORANGSUM-VP-XJVV6T (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

287 nt

GACACCGGAATTACCCAAACACCAAAACACCTGGTCATGGGAATGGCAAATAAGAAGTCTTTGAAATGTGAACAACATATGGGGCACAATGCTATGTACTGGTACAAGCAGAAAGCGAAGTAGCCGCCGGAGCTCATGTTTGTCTACAATTATGAGAAACTCTCTATAAATGAAAGTGTGCCAAGTCGCATCTCACCTGAATGCCCCAAGAGCTCTCTCTTAAACCTTCACCTACACGCCCTGCAGCCAGAAGACTCGGCCCTGTATCTCTGCGCCAGCAGCAAAGA

Amino-acid sequence (V-REGION)

95 aa

DTGITQTPKHLVMGMANKKSLKCEQHMGHNAMYWYKQKAK*PPELMFVYNYEKLSINESVPSRISPECPKSSLLNLHLHALQPEDSALYLCASSK

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (ORANGSUM-VKOZSEJ6U). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
TRBV4-2*01	IMGT	IMGT

External records i

IMGT: TRBV4-2*01

Literature references 19 total · 19 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
22792299	Unbiased analysis of TCRα/β chains at the single-cell level in human CD8+ T-cell subsets.	name mentioned^*	literature_supp
26962778	High Throughput Sequencing of T Cell Antigen Receptors Reveals a Conserved TCR Repertoire.	name mentioned^*	literature_supp
31237075	Comparative analysis of CDR3 regions in paired human αβ CD8 T cells.	name mentioned^*	literature_supp
34845983	TCR meta-clonotypes for biomarker discovery with tcrdist3 enabled identification of public, HLA-restricted clusters of SARS-CoV-2 TCRs.	name mentioned^*	literature_supp
35436998	pmTR database: population matched (pm) germline allelic variants of T-cell receptor (TR) loci.	name mentioned^*	literature_supp
36408799	SARS-CoV-2-specific CD4+ and CD8+ T cell responses can originate from cross-reactive CMV-specific T cells.	name mentioned^*	literature_supp
36603583	Improved predictions of antigen presentation and TCR recognition with MixMHCpred2.2 and PRIME2.0 reveal potent SARS-CoV-2 CD8+ T-cell epitopes.	name mentioned^*	literature_supp
36923729	Cross-reactivity influences changes in human influenza A virus and Epstein Barr virus specific CD8 memory T cell receptor alpha and beta repertoires between young and old.	name mentioned^*	literature_supp
37287989	Targeting KRASG12V mutations with HLA class II-restricted TCR for the immunotherapy in solid tumors.	name mentioned^*	literature_supp
38304555	SARS-CoV-2-associated T-cell infiltration in the central nervous system.	name mentioned^*	literature_supp
38871688	Germline-like TCR-α chains shared between autoreactive T cells in blood and pancreas.	name mentioned^*	literature_supp
38878776	Quantifiable TCR repertoire changes in prediagnostic blood specimens among patients with high-grade ovarian cancer.	name mentioned^*	literature_supp
39421738	scRNA+TCR-seq reveals the pivotal role of dual receptor T lymphocytes in the pathogenesis of Kawasaki disease and during IVIG treatment.	name mentioned^*	literature_supp
40165973	T-cell receptors identified by a personalized antigen-agnostic screening approach target shared neoantigen KRAS Q61H.	name mentioned^*	literature_supp
40664667	High-resolution mapping of single cells in spatial context.	name mentioned^*	literature_supp
40866291	Spatial TCR clonality and clonal expansion in the in situ microenvironment of non-small cell lung cancer.	name mentioned^*	literature_supp
40877317	Molecular basis of potent antiviral HLA-C-restricted CD8+ T cell response to an immunodominant SARS-CoV-2 nucleocapsid epitope.	name mentioned^*	literature_supp
41150899	Large-Scale T-cell Receptor Repertoire Profiling Unveils Tumor-Specific Signals for Diagnosing Indeterminate Pulmonary Nodules.	name mentioned^*	literature_supp
41424382	Identification of Sjögren's disease-associated T cell receptor motifs through deep sequencing.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGCCTTGCAGAGTCACCGCTTTCCTGTGCAGAAACC	IMGT	ORANGSUM-RTBG4X

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
AGGGACTGCAGGCTGCTCTGCTGTGTGGTTCTCTGTCCCCTGGGAGCAGTCCCCATA	49 + 8 nt	IMGT	ORANGSUM-LXXXKM

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/ORANGSUM-VKOZSEJ6U/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases