RABBIT-VVRIWUPYF

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesOryctolagus cuniculus LocusTRB TypeV FunctionalTrue Length284 nt

TRBV6-5*01: a Oryctolagus cuniculus TRB V allele sequence, 284 nt, functional. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Oryctolagus cuniculus (NCBITAXON:9986)
Locus / type	TRB / V
Functional i	True
Length	284 nt
Protein UID i	RABBIT-VP-LGWMO6 (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

284 nt

AATGCTGGTGTCACCCAGAGCCCCAAGTTCCAGGTCCTAAAGACAGGACAGAGCCTGACCTTGAGATGTGCCCAGGATATGAACTATGACTACATGTGCTGGTACCGCCAGGACCCAGGGCTGGGGCTGAAGCTCATCTATTACTCAGTTGACCGTGACATCTATGAGATAGGAGAGGTCTCGGATGGGTACAACGTGTCCAGACCAAGCACAGAGGAGTTCCCCCTCACGTTGCTGTCAGCTGTCCCCTCGCAGACATCTGTGTACTTCTGTGCAGCAATTAC

Amino-acid sequence (V-REGION)

94 aa

NAGVTQSPKFQVLKTGQSLTLRCAQDMNYDYMCWYRQDPGLGLKLIYYSVDRDIYEIGEVSDGYNVSRPSTEEFPLTLLSAVPSQTSVYFCAAI

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (RABBIT-VVRIWUPYF). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
TRBV6-5*01	IMGT	IMGT

External records i

IMGT: TRBV6-5*01

Literature references 29 total · 29 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
22792299	Unbiased analysis of TCRα/β chains at the single-cell level in human CD8+ T-cell subsets.	name mentioned^*	literature_supp
26962778	High Throughput Sequencing of T Cell Antigen Receptors Reveals a Conserved TCR Repertoire.	name mentioned^*	literature_supp
30152754	Human T cell receptor occurrence patterns encode immune history, genetic background, and receptor specificity.	name mentioned^*	literature_supp
31237075	Comparative analysis of CDR3 regions in paired human αβ CD8 T cells.	name mentioned^*	literature_supp
32668259	CD4+ T Cells Recognize Conserved Influenza A Epitopes through Shared Patterns of V-Gene Usage and Complementary Biochemical Features.	name mentioned^*	literature_supp
34845983	TCR meta-clonotypes for biomarker discovery with tcrdist3 enabled identification of public, HLA-restricted clusters of SARS-CoV-2 TCRs.	name mentioned^*	literature_supp
35004747	Altered T-Cell Receptor β-Chain and Lactate Dehydrogenase Are Associated With the Immune Pathogenesis of Biliary Atresia.	name mentioned^*	literature_supp
36408799	SARS-CoV-2-specific CD4+ and CD8+ T cell responses can originate from cross-reactive CMV-specific T cells.	name mentioned^*	literature_supp
36603583	Improved predictions of antigen presentation and TCR recognition with MixMHCpred2.2 and PRIME2.0 reveal potent SARS-CoV-2 CD8+ T-cell epitopes.	name mentioned^*	literature_supp
36923729	Cross-reactivity influences changes in human influenza A virus and Epstein Barr virus specific CD8 memory T cell receptor alpha and beta repertoires between young and old.	name mentioned^*	literature_supp
37287989	Targeting KRASG12V mutations with HLA class II-restricted TCR for the immunotherapy in solid tumors.	name mentioned^*	literature_supp
38304555	SARS-CoV-2-associated T-cell infiltration in the central nervous system.	name mentioned^*	literature_supp
38336680	NY-ESO-1-specific T cell receptor-engineered T cells and Tranilast, a TRPV2 antagonist bivalent treatment enhances the killing of esophageal cancer: a dual-targeted cancer therapeutic route.	name mentioned^*	literature_supp
38871688	Germline-like TCR-α chains shared between autoreactive T cells in blood and pancreas.	name mentioned^*	literature_supp
38878776	Quantifiable TCR repertoire changes in prediagnostic blood specimens among patients with high-grade ovarian cancer.	name mentioned^*	literature_supp
38954022	Identification and validation of tumor-specific T cell receptors from tumor infiltrating lymphocytes using tumor organoid co-cultures.	name mentioned^*	literature_supp
39133650	Expansion of the HSV-2-specific T cell repertoire in skin after immunotherapeutic HSV-2 vaccine.	name mentioned^*	literature_supp
39421738	scRNA+TCR-seq reveals the pivotal role of dual receptor T lymphocytes in the pathogenesis of Kawasaki disease and during IVIG treatment.	name mentioned^*	literature_supp
39472557	Physiological and pathogenic T cell autoreactivity converge in type 1 diabetes.	name mentioned^*	literature_supp
40498839	Phage display enables machine learning discovery of cancer antigen-specific TCRs.	name mentioned^*	literature_supp
40664667	High-resolution mapping of single cells in spatial context.	name mentioned^*	literature_supp
40775219	Integrative multi-omics reveals a regulatory and exhausted T-cell landscape in CLL and identifies galectin-9 as an immunotherapy target.	name mentioned^*	literature_supp
40877317	Molecular basis of potent antiviral HLA-C-restricted CD8+ T cell response to an immunodominant SARS-CoV-2 nucleocapsid epitope.	name mentioned^*	literature_supp
41150899	Large-Scale T-cell Receptor Repertoire Profiling Unveils Tumor-Specific Signals for Diagnosing Indeterminate Pulmonary Nodules.	name mentioned^*	literature_supp
41306962	Promiscuous class II-binding SARS-CoV-2-nuc derived vaccine-peptide induced extensive conventional, innate and unconventional T cell responses.	name mentioned^*	literature_supp
41424382	Identification of Sjögren's disease-associated T cell receptor motifs through deep sequencing.	name mentioned^*	literature_supp
41766885	Correction: Promiscuous class II-binding SARS-CoV-2-nuc derived vaccine-peptide induced extensive conventional, innate and unconventional T cell responses.	name mentioned^*	literature_supp
41898550	Single-Cell Multi-Tissue T Cell Clonal Dynamics Reveal Distinct Immune Coercion Landscapes in MSI and MSS Colorectal Cancer.	name mentioned^*	literature_supp
42125653	N-terminal pyroglutamylation of an HLA-A24-restricted immunodominant epitope enhances SARS-CoV-2-specific T-cell responses.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGCCCTGCACAGCCACCTGCTGTCTGCACATAAACC	IMGT	RABBIT-RMESE4

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGAGTGTGGGTCCCCTGAGCTGTGTGGTCCTTTGTCTCCTGCTGGCAGGTCCAGCG	49 + 8 nt	IMGT	RABBIT-LJM6UO

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/RABBIT-VVRIWUPYF/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases