RAT-VGAXBC6L7

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesRattus norvegicus LocusIGH TypeV FunctionalNone Length309 nt

IGHV1-58*01: a Rattus norvegicus IGH V allele sequence, 309 nt, not recorded. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Rattus norvegicus (NCBITAXON:10116)
Locus / type	IGH / V
Functional i	None
Length	309 nt
Protein UID i	RAT-VP-YWVD65 (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

309 nt

CAGATTCAGCTTCAGCAGTGTGGATTTGATCTGCAGAGGCCTGGGGCTTCAGTGAAGTTGTCCTGCCAGAATTCTTACTTCAGCTTCAGGAGGCAGTTTTGCAGCAGCTACTATATGAGCTGGGGGAAACAGAGACCTGGAAAGGGCATGGAAAGGATTGGTTATATTAATATTTACAATGGTGACACTAACTATATTCAGAAGTTCAAAGGCAAGGCCACATTGACTAGAGATACATCCTCCAAAACTGCTTACATGAAACCCAGCAGCCTGGTATATGAAGACTCTGTGGTCTATTAATGTGCAAGA

Amino-acid sequence (V-REGION)

103 aa

QIQLQQCGFDLQRPGASVKLSCQNSYFSFRRQFCSSYYMSWGKQRPGKGMERIGYINIYNGDTNYIQKFKGKATLTRDTSSKTAYMKPSSLVYEDSVVY*CAR

Translated here from the nucleotide sequence; no source published a protein for this allele. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (RAT-VGAXBC6L7). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV1-58*01	IMGT	IMGT

External records i

IMGT: IGHV1-58*01

Literature references 29 total · 29 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
29545810	Repertoire Analysis of Antibody CDR-H3 Loops Suggests Affinity Maturation Does Not Typically Result in Rigidification.	name mentioned^*	literature_supp
31839985	More than one antibody of individual B cells revealed by single-cell immune profiling.	name mentioned^*	literature_supp
32156260	Tracing CLL-biased stereotyped immunoglobulin gene rearrangements in normal B cell subsets using a high-throughput immunogenetic approach.	name mentioned^*	literature_supp
32425948	AID Overlapping and Polη Hotspots Are Key Features of Evolutionary Variation Within the Human Antibody Heavy Chain (IGHV) Genes.	name mentioned^*	literature_supp
32636395	IgCaller for reconstructing immunoglobulin gene rearrangements and oncogenic translocations from whole-genome sequencing in lymphoid neoplasms.	name mentioned^*	literature_supp
33048842	Antimalarial antibody repertoire defined by plasma IG proteomics and single B cell IG sequencing.	name mentioned^*	literature_supp
33893175	Nanobody cocktails potently neutralize SARS-CoV-2 D614G N501Y variant and protect mice.	name mentioned^*	literature_supp
34126625	Naturally enhanced neutralizing breadth against SARS-CoV-2 one year after infection.	name mentioned^*	literature_supp
34614412	mRNA vaccination of naive and COVID-19-recovered individuals elicits potent memory B cells that recognize SARS-CoV-2 variants.	name mentioned^*	literature_supp
34785098	Landscapes and dynamic diversifications of B-cell receptor repertoires in COVID-19 patients.	name mentioned^*	literature_supp
35776090	Antibody evolution to SARS-CoV-2 after single-dose Ad26.COV2.S vaccine in humans.	name mentioned^*	literature_supp
35837088	Characterizing Features of Human Circulating B Cells Carrying CLL-Like Stereotyped Immunoglobulin Rearrangements.	name mentioned^*	literature_supp
36006380	Humoral immunity to SARS-CoV-2 elicited by combination COVID-19 vaccination regimens.	name mentioned^*	literature_supp
36149398	Memory B cell responses to Omicron subvariants after SARS-CoV-2 mRNA breakthrough infection in humans.	name mentioned^*	literature_supp
36328595	Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing.	name mentioned^*	literature_supp
36473496	Antibody feedback regulates immune memory after SARS-CoV-2 mRNA vaccination.	name mentioned^*	literature_supp
36827454	Modeling and predicting the overlap of B- and T-cell receptor repertoires in healthy and SARS-CoV-2 infected individuals.	name mentioned^*	literature_supp
37368240	Memory B cell development elicited by mRNA booster vaccinations in the elderly.	name mentioned^*	literature_supp
38205245	Comprehensive characterization and database construction of immune repertoire in the largest Chinese glioma cohort.	name mentioned^*	literature_supp
38435425	Analysis of immunoglobulin/T-cell receptor repertoires by high-throughput RNA sequencing reveals a continuous dynamic of positive clonal selection in follicular lymphoma.	name mentioned^*	literature_supp
39698082	Comprehensive method for producing high-affinity mouse monoclonal antibodies of various isotypes against (4-hydroxy-3-nitrophenyl)acetyl (NP) hapten.	name mentioned^*	literature_supp
39840032	An allelic atlas of immunoglobulin heavy chain variable regions reveals antibody binding epitope preference resilient to SARS-CoV-2 mutation escape.	name mentioned^*	literature_supp
40066131	Characterization of Immunoglobulin Heavy Locus Rearrangements in Molecular Subtypes of Childhood B-Cell Precursor Acute Lymphoblastic Leukemia.	name mentioned^*	literature_supp
40664667	High-resolution mapping of single cells in spatial context.	name mentioned^*	literature_supp
41410768	Convergent mutation trajectories convert functional self-tolerance in IGHV4-34 B cells to genetic tolerance encoded in the antibody.	name mentioned^*	literature_supp
41606257	Allergen-specific human IgE isolated through an allergen-agnostic pipeline-understanding immune response and allergen recognition.	name mentioned^*	literature_supp
41617721	Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity.	name mentioned^*	literature_supp
41803327	IFN-gene signatures in B cells following influenza A and B virus infection and influenza vaccination.	name mentioned^*	literature_supp
42078068	B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGGAATAGAGTTGAATCTTTCTCTTTGCCCTCTAAGTAACTGCAGGTGTTCACTCC	46 + 11 nt	IMGT	RAT-LMXBPN

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/RAT-VGAXBC6L7/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases