RAT-VYEX73J5U

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesRattus norvegicus LocusIGH TypeV FunctionalNone Length296 nt

IGHV4-4*01: a Rattus norvegicus IGH V allele sequence, 296 nt, not recorded. The nucleotide and amino-acid sequence is below, with every recorded name and its source.

Species	Rattus norvegicus (NCBITAXON:10116)
Locus / type	IGH / V
Functional i	None
Length	296 nt
Protein UID i	RAT-VP-EDIV5Y (shared by alleles with the same V-REGION amino-acid sequence)

Coding sequence (nt)

296 nt

GGGGTGAAGCTTGTTGAGACTGGAGGTGGCCTGGTATAGTCTGGAAAATCCTTGAGGCTCTCCTGTGCAACCTCCATATTCAGTTTTAATAGCTAATGGATGAGCTGGAACCGGGAGACTCCAGGGAAGGGGCCAGAATGAATTGGAGAAATTAATCCAGCTGACAGTACAGTAAACTACACACCATCTTTAGGGGATAAATTCACCATATCCAGAGACAATACCCAAAACACTCTCTACCTGCAAATGAATAAAATGTGATCTGAGGACACAGCCAGTAATTACTGCACAATGGA

Amino-acid sequence (V-REGION)

98 aa

GVKLVETGGGLV*SGKSLRLSCATSIFSFNS*WMSWNRETPGKGPE*IGEINPADSTVNYTPSLGDKFTISRDNTQNTLYLQMNKM*SEDTASNYCTM

Published by the source, and consistent with the nucleotide sequence above. i

Name history i: stable — no former names, re-cuts, or archival on record.

Allele names i

Every name below denotes this exact sequence (RAT-VYEX73J5U). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV4-4*01	IMGT	IMGT

External records i

IMGT: IGHV4-4*01

Literature references 17 total · 17 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
19563687	Isolation of a human-like antibody fragment (scFv) that neutralizes ricin biological activity.	name mentioned^*	literature_supp
31839985	More than one antibody of individual B cells revealed by single-cell immune profiling.	name mentioned^*	literature_supp
33048842	Antimalarial antibody repertoire defined by plasma IG proteomics and single B cell IG sequencing.	name mentioned^*	literature_supp
33095260	Longevity, clonal relationship, and transcriptional program of celiac disease-specific plasma cells.	name mentioned^*	literature_supp
33717051	Poorly Expressed Alleles of Several Human Immunoglobulin Heavy Chain Variable Genes are Common in the Human Population.	name mentioned^*	literature_supp
34175903	Immunoglobulin germline gene variation and its impact on human disease.	name mentioned^*	literature_supp
34667305	Commentary on Population matched (pm) germline allelic variants of immunoglobulin (IG) loci: relevance in infectious diseases and vaccination studies in human populations.	name mentioned^*	literature_supp
34671351	Computational Inference, Validation, and Analysis of 5'UTR-Leader Sequences of Alleles of Immunoglobulin Heavy Chain Variable Genes.	name mentioned^*	literature_supp
36328595	Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing.	name mentioned^*	literature_supp
37291228	B cell profiles, antibody repertoire and reactivity reveal dysregulated responses with autoimmune features in melanoma.	name mentioned^*	literature_supp
38406579	AIRR-C IG Reference Sets: curated sets of immunoglobulin heavy and light chain germline genes.	name mentioned^*	literature_supp
39489605	An unbiased comparison of immunoglobulin sequence aligners.	name mentioned^*	literature_supp
39840032	An allelic atlas of immunoglobulin heavy chain variable regions reveals antibody binding epitope preference resilient to SARS-CoV-2 mutation escape.	name mentioned^*	literature_supp
40066131	Characterization of Immunoglobulin Heavy Locus Rearrangements in Molecular Subtypes of Childhood B-Cell Precursor Acute Lymphoblastic Leukemia.	name mentioned^*	literature_supp
40118521	De novo antibody identification in human blood from full-length single B cell transcriptomics and matching haplotype-resolved germline assemblies.	name mentioned^*	literature_supp
41617721	Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity.	name mentioned^*	literature_supp
42078068	B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGTGAAGACACCACAGATTGGACCCTGACATGAACT	IMGT	RAT-RMIHLG

Find similar (nt · aa · cross-species) i

Everything comparative about this sequence (the exact differences to other alleles, protein consequence, IMGT alignment, cross-species nearest) is shown per hit in the results of this query.

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/RAT-VYEX73J5U/similar?min_identity=0.95&kind=nt.

API: JSON · AIRR AlleleDescription · aliases