AIRBabel immunoglobulin and T-cell receptor allele sequences · leaders · RSSs

← back to search

RHESUS-V2D3TLY4D

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMacaca mulatta LocusIGH TypeV FunctionalNone Length298 nt
SpeciesMacaca mulatta (NCBITAXON:9544)
Locus / typeIGH / V
Functional iNone
Length298 nt
Protein UID iRHESUS-VP-WU27VE (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (RHESUS-V2D3TLY4D). None is canonical; they are labels, and the UID is the key.

NameSchemeSource(s)
IGHV3-23*02 IMGT IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

NameKindSource(s)
DQ100670.1 NCBI accession ncbi_nucleotide

Former IMGT names i

Former nameLast seen in IMGT release
IGHV3-16*012013-01-20

External records i

NCBI nucleotide: link IMGT: IGHV3-23*02

Literature references 21 total · 21 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMIDTitleEvidenceSource
26194754 Assigning and visualizing germline genes in antibody repertoires. name mentioned* literature_supp
26848863 Clonal relationships in recurrent B-cell lymphomas. name mentioned* literature_supp
28125682 The Number of Overlapping AID Hotspots in Germline IGHV Genes Is Inversely Correlated with Mutation Frequency in Chronic Lymphocytic Leukemia. name mentioned* literature_supp
29545810 Repertoire Analysis of Antibody CDR-H3 Loops Suggests Affinity Maturation Does Not Typically Result in Rigidification. name mentioned* literature_supp
29558968 BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data. name mentioned* literature_supp
31602484 VDJbase: an adaptive immune receptor genotype and haplotype database. name mentioned* literature_supp
31839985 More than one antibody of individual B cells revealed by single-cell immune profiling. name mentioned* literature_supp
32636395 IgCaller for reconstructing immunoglobulin gene rearrangements and oncogenic translocations from whole-genome sequencing in lymphoid neoplasms. name mentioned* literature_supp
33048842 Antimalarial antibody repertoire defined by plasma IG proteomics and single B cell IG sequencing. name mentioned* literature_supp
34764956 Novel Allele Detection Tool Benchmark and Application With Antibody Repertoire Sequencing Dataset. name mentioned* literature_supp
34785098 Landscapes and dynamic diversifications of B-cell receptor repertoires in COVID-19 patients. name mentioned* literature_supp
35419009 Addressing IGHV Gene Structural Diversity Enhances Immunoglobulin Repertoire Analysis: Lessons From Rhesus Macaque. name mentioned* literature_supp
35734588 Case Report: Sequential Development of Three Mature Lymphoid Neoplasms in a Single Patient: Clonal Relationship and Molecular Insights. name mentioned* literature_supp
36328595 Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing. name mentioned* literature_supp
36353774 High activation levels maintained in receptor-binding domain-specific memory B cells in people with severe coronavirus disease 2019. name mentioned* literature_supp
38435425 Analysis of immunoglobulin/T-cell receptor repertoires by high-throughput RNA sequencing reveals a continuous dynamic of positive clonal selection in follicular lymphoma. name mentioned* literature_supp
38643233 An ancestral SARS-CoV-2 vaccine induces anti-Omicron variants antibodies by hypermutation. name mentioned* literature_supp
38961347 Systematic characterization of immunoglobulin loci and deep sequencing of the expressed repertoire in the Atlantic cod (Gadus morhua). name mentioned* literature_supp
39840032 An allelic atlas of immunoglobulin heavy chain variable regions reveals antibody binding epitope preference resilient to SARS-CoV-2 mutation escape. name mentioned* literature_supp
41617721 Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity. name mentioned* literature_supp
42078068 B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies. name mentioned* literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

PartSequenceSourceRSS UID
v_rsCACAGTGAGGGGAGGTCAGTGTGAGCCCAGACACAAACC IMGT RHESUS-R6AAZB

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/RHESUS-V2D3TLY4D/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

298 nt
GAGGTGCAGCTGGTGGAGTCTGGGGGAGCCTCGGTACAGCCTGGGGCGTCCCTGAGACTCTGCTGTGCAGCCTCTGGATTCACCTTCAGTAGCACCAGGATGAACTGGATCCGACAGGCTCCAGGGAAGAAGCTGGAGTGGGTGACTGACATAAAGTAGGATGGAAGTGAGAAATACTATGTAGACTCTGTGAAGGGCCGATTCACCATCTCCAGAGACAATGCCAAGAACTCCCTCTATCTGCAAATGAACAGCCTGAGAGCTGAGGGGACACAGCCGTGTATTACTGTGTGAGAGA

Amino-acid sequence (V-REGION)

99 aa
EVQLVESGGASVQPGASLRLCCAASGFTFSSTRMNWIRQAPGKKLEWVTDIK*DGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEGTQPCITV*E

Translated here from the nucleotide sequence; no source published a protein for this allele. i