AIRBabel immunoglobulin and T-cell receptor allele sequences · leaders · RSSs

← back to search

RHESUS-V7QWLN5UA

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMacaca mulatta LocusIGH TypeV FunctionalNone Length293 nt
SpeciesMacaca mulatta (NCBITAXON:9544)
Locus / typeIGH / V
Functional iNone
Length293 nt
Protein UID iRHESUS-VP-5ATQ37 (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (RHESUS-V7QWLN5UA). None is canonical; they are labels, and the UID is the key.

NameSchemeSource(s)
IGHV3-6MZB*03 IgLabel MUSA
IGHV3-ADW*03 RhGLDB+ RhGLDB+

External records i

genbank:MF989611: GENBANK:MF989611

Literature references 2 total · 1 verified · 1 sequence-in-paper i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence.

PMIDTitleEvidenceSource
29163486 verified MUSA
32866207 Mapping the immunogenic landscape of near-native HIV-1 envelope trimers in non-human primates. sequence in paper literature_supp

Contributed by MUSA, RhGLDB+. See Sources & citations for each source's version, citation and licence.

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/RHESUS-V7QWLN5UA/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

293 nt
GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTGCAACCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCATCTGGATTCACCATCAGTAGCTCCTGGATGAACTGGGACTTCCAGGCTCCAGGAAAGGGGCTGGAGTGTGTCTCACATATTAGTAGTGGTGTTAGCACAGACTACCCAGATTCTATCAAGGGCCAATTCACCATCTCCAGAGACAATACCGAGACCATGCTGTATGTGCAAATGAACAGCCTGAGAGCTGAGGACATGGCTGTGAATTACTGTGCAAGAGA

Amino-acid sequence (V-REGION)

97 aa
EVQLVESGGGLVQPGGSLRLSCAASGFTISSSWMNWDFQAPGKGLECVSHISSGVSTDYPDSIKGQFTISRDNTETMLYVQMNSLRAEDMAVNYCAR

Translated here from the nucleotide sequence; no source published a protein for this allele. i