AIRBabel immunoglobulin and T-cell receptor allele sequences · leaders · RSSs

← back to search

RHESUS-VC42AGWTY

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMacaca mulatta LocusIGH TypeV FunctionalTrue Length296 nt
SpeciesMacaca mulatta (NCBITAXON:9544)
Locus / typeIGH / V
Functional iTrue
Length296 nt
Protein UID iRHESUS-VP-24K5RM (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (RHESUS-VC42AGWTY). None is canonical; they are labels, and the UID is the key.

Multiple allele designations. This one sequence is recorded under 3 different allele designations: IGHV3-100*02, IGHV3-73*01, IGHV3-AAB*01. These are identical normalized nucleotide sequences with different attributed names.

NameSchemeSource(s)
IGHV3-2RXM*13 IgLabel MUSA
IGHV3-HFYN*04 IgLabel OGRDB
IGHV3-100*02 IMGT IMGT
IGHV3-73*01 KIMDB KIMDB
IGHV3-AAB*01 RhGLDB+ RhGLDB+

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

NameKindSource(s)
NW_001122023.1 NCBI accession ncbi_nucleotide

External records i

genbank:MF989485: GENBANK:MF989485 NCBI nucleotide: link NCBI Gene: NCBIGENE:720866 GenBank: GENBANK:NW_001122023 IMGT: IGHV3-100*02 OGRDB: IGHV3-HFYN*04

Literature references 33 total · 4 verified · 2 sequence-in-paper · 27 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMIDTitleEvidenceSource
25319573 verified MUSA
27525066 verified MUSA
29163486 verified MUSA
31080066 verified MUSA
32866207 Mapping the immunogenic landscape of near-native HIV-1 envelope trimers in non-human primates. sequence in paper literature_supp
35419009 Addressing IGHV Gene Structural Diversity Enhances Immunoglobulin Repertoire Analysis: Lessons From Rhesus Macaque. sequence in paper literature_supp
29545810 Repertoire Analysis of Antibody CDR-H3 Loops Suggests Affinity Maturation Does Not Typically Result in Rigidification. name mentioned* literature_supp
29558968 BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data. name mentioned* literature_supp
30697215 VH1-69 Utilizing Antibodies Are Capable of Mediating Non-neutralizing Fc-Mediated Effector Functions Against the Transmitted/Founder gp120. name mentioned* literature_supp
31839985 More than one antibody of individual B cells revealed by single-cell immune profiling. name mentioned* literature_supp
32425948 AID Overlapping and Polη Hotspots Are Key Features of Evolutionary Variation Within the Human Antibody Heavy Chain (IGHV) Genes. name mentioned* literature_supp
33048842 Antimalarial antibody repertoire defined by plasma IG proteomics and single B cell IG sequencing. name mentioned* literature_supp
33485405 Enhancement versus neutralization by SARS-CoV-2 antibodies from a convalescent donor associates with distinct epitopes on the RBD. name mentioned* literature_supp
33843586 Distinct clonal evolution of B-cells in HIV controllers with neutralizing antibody breadth. name mentioned* literature_supp
34242577 In vitro and in vivo functions of SARS-CoV-2 infection-enhancing and neutralizing antibodies. name mentioned* literature_supp
34764956 Novel Allele Detection Tool Benchmark and Application With Antibody Repertoire Sequencing Dataset. name mentioned* literature_supp
34785098 Landscapes and dynamic diversifications of B-cell receptor repertoires in COVID-19 patients. name mentioned* literature_supp
35837088 Characterizing Features of Human Circulating B Cells Carrying CLL-Like Stereotyped Immunoglobulin Rearrangements. name mentioned* literature_supp
36006380 Humoral immunity to SARS-CoV-2 elicited by combination COVID-19 vaccination regimens. name mentioned* literature_supp
36328595 Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing. name mentioned* literature_supp
36353774 High activation levels maintained in receptor-binding domain-specific memory B cells in people with severe coronavirus disease 2019. name mentioned* literature_supp
36827454 Modeling and predicting the overlap of B- and T-cell receptor repertoires in healthy and SARS-CoV-2 infected individuals. name mentioned* literature_supp
37114042 Adaptive immune receptor genotyping using the corecount program. name mentioned* literature_supp
37368240 Memory B cell development elicited by mRNA booster vaccinations in the elderly. name mentioned* literature_supp
38042809 Interaction dynamics between innate and adaptive immune cells responding to SARS-CoV-2 vaccination in non-human primates. name mentioned* literature_supp
38435425 Analysis of immunoglobulin/T-cell receptor repertoires by high-throughput RNA sequencing reveals a continuous dynamic of positive clonal selection in follicular lymphoma. name mentioned* literature_supp
38643233 An ancestral SARS-CoV-2 vaccine induces anti-Omicron variants antibodies by hypermutation. name mentioned* literature_supp
39840032 An allelic atlas of immunoglobulin heavy chain variable regions reveals antibody binding epitope preference resilient to SARS-CoV-2 mutation escape. name mentioned* literature_supp
40066131 Characterization of Immunoglobulin Heavy Locus Rearrangements in Molecular Subtypes of Childhood B-Cell Precursor Acute Lymphoblastic Leukemia. name mentioned* literature_supp
40664667 High-resolution mapping of single cells in spatial context. name mentioned* literature_supp
41606257 Allergen-specific human IgE isolated through an allergen-agnostic pipeline-understanding immune response and allergen recognition. name mentioned* literature_supp
41617721 Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity. name mentioned* literature_supp
42078068 B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies. name mentioned* literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, KIMDB, MUSA, OGRDB, RhGLDB+, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

PartSequenceSourceRSS UID
v_rsCACAGTGAGGAGAAGTCAGTGTGAGCCCAGACACAAAAC MUSA RHESUS-R3MS3L
v_rsCACAGTGAGGAGAAGTCAGTGTGAGCCCAGACACAAACC IMGT MUSA RHESUS-RZ3UTX

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)SplitSourceLeader UID
ATGGAGTTTGTGCTGAGTTTGGTTTTCCTTGTTGCTATTTTAAAAGGTGTCCAGTGT 46 + 11 nt IMGT RHESUS-LE3VYC
ATGGAGTTTGTGCTGAGTTTGGTTTTCCTTGTTGCTATTTTAAAAGGTGTGTCCAGTGT 48 + 11 nt MUSA RHESUS-LGOQGS

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/RHESUS-VC42AGWTY/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

296 nt
GACGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTAAAGCCTGGGGGGTCCCTGAGACTCTCTTGTGTAGCCTCTGGGTTCACCTTCAGTAGCTACGAAATGCACTGGGTCCGCCAGGCTCCAGGAAAGGGTCTGGAGTGGGTCTCAGTTATTAGTGAAAGTGGTGGTACCACATACTACGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACTCACTGTTTCTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCCGTGTATTACTGTACTAGAGA

Amino-acid sequence (V-REGION)

98 aa
DVQLVESGGGLVKPGGSLRLSCVASGFTFSSYEMHWVRQAPGKGLEWVSVISESGGTTYYADSVKGRFTISRDNAKNSLFLQMNSLRAEDTAVYYCTR

Published by the source, and consistent with the nucleotide sequence above. i