AIRBabel immunoglobulin and T-cell receptor allele sequences · leaders · RSSs

← back to search

RHESUS-VCAXRB66D

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMacaca mulatta LocusIGL TypeV FunctionalTrue Length290 nt
SpeciesMacaca mulatta (NCBITAXON:9544)
Locus / typeIGL / V
Functional iTrue
Length290 nt
Protein UID iRHESUS-VP-7BMH6A (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (RHESUS-VCAXRB66D). None is canonical; they are labels, and the UID is the key.

Multiple allele designations. This one sequence is recorded under 2 different allele designations: IGLV3-16*02, IGLV3-AEB*02. These are identical normalized nucleotide sequences with different attributed names.

NameSchemeSource(s)
IGLV12-3L7Q*01 IgLabel MUSA, OGRDB
IGLV3-16*02 IMGT IMGT
IGLV3-AEB*02 RhGLDB+ RhGLDB+

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

NameKindSource(s)
NW_001095158.1 NCBI accession ncbi_nucleotide

Former IMGT names i

Former nameLast seen in IMGT release
IGLV3-10*012016-12-19

External records i

genbank:MF989887: GENBANK:MF989887 genbank:NW_001095158: GENBANK:NW_001095158 NCBI nucleotide: link GenBank: GENBANK:NW_001095158 IMGT: IGLV3-16*02 OGRDB: IGLV12-3L7Q*01

Literature references 24 total · 4 verified · 1 sequence-in-paper · 19 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMIDTitleEvidenceSource
25319530 verified MUSA
27525066 verified MUSA
29163486 verified MUSA
31080066 verified MUSA
32866207 Mapping the immunogenic landscape of near-native HIV-1 envelope trimers in non-human primates. sequence in paper literature_supp
25330199 Characteristics of memory B cells elicited by a highly efficacious HPV vaccine in subjects with no pre-existing immunity. name mentioned* literature_supp
25338678 Sequencing of the human IG light chain loci from a hydatidiform mole BAC library reveals locus-specific signatures of genetic diversity. name mentioned* literature_supp
28813462 A comprehensive profiling of T- and B-lymphocyte receptor repertoires from a Chinese-origin rhesus macaque by high-throughput sequencing. name mentioned* literature_supp
29545810 Repertoire Analysis of Antibody CDR-H3 Loops Suggests Affinity Maturation Does Not Typically Result in Rigidification. name mentioned* literature_supp
29558968 BALDR: a computational pipeline for paired heavy and light chain immunoglobulin reconstruction in single-cell RNA-seq data. name mentioned* literature_supp
30697215 VH1-69 Utilizing Antibodies Are Capable of Mediating Non-neutralizing Fc-Mediated Effector Functions Against the Transmitted/Founder gp120. name mentioned* literature_supp
31839985 More than one antibody of individual B cells revealed by single-cell immune profiling. name mentioned* literature_supp
33048842 Antimalarial antibody repertoire defined by plasma IG proteomics and single B cell IG sequencing. name mentioned* literature_supp
34126625 Naturally enhanced neutralizing breadth against SARS-CoV-2 one year after infection. name mentioned* literature_supp
34242577 In vitro and in vivo functions of SARS-CoV-2 infection-enhancing and neutralizing antibodies. name mentioned* literature_supp
34587480 Paired heavy- and light-chain signatures contribute to potent SARS-CoV-2 neutralization in public antibody responses. name mentioned* literature_supp
35447092 Analysis of memory B cells identifies conserved neutralizing epitopes on the N-terminal domain of variant SARS-Cov-2 spike proteins. name mentioned* literature_supp
35776090 Antibody evolution to SARS-CoV-2 after single-dose Ad26.COV2.S vaccine in humans. name mentioned* literature_supp
36328595 Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing. name mentioned* literature_supp
37076511 Vaccination of SARS-CoV-2-infected individuals expands a broad range of clonally diverse affinity-matured B cell lineages. name mentioned* literature_supp
38205245 Comprehensive characterization and database construction of immune repertoire in the largest Chinese glioma cohort. name mentioned* literature_supp
38435425 Analysis of immunoglobulin/T-cell receptor repertoires by high-throughput RNA sequencing reveals a continuous dynamic of positive clonal selection in follicular lymphoma. name mentioned* literature_supp
40664667 High-resolution mapping of single cells in spatial context. name mentioned* literature_supp
41803327 IFN-gene signatures in B cells following influenza A and B virus infection and influenza vaccination. name mentioned* literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, MUSA, OGRDB, RhGLDB+, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

PartSequenceSourceRSS UID
v_rsCACAGTGACACTGGCAGATGGGGAAGTGAGACATAAACC IMGT MUSA RHESUS-RPQZQ3

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)SplitSourceLeader UID
ATGGCCTGGATTCCTCTCCTACTCCCCCGCCTCACTTTCTGCACAGGTGCTCTGCAGCC 48 + 11 nt MUSA RHESUS-LD7XVV
ATGGCCTGGATTCCTCTCCTACTCCCCCTCCTCACTTTCTGCACAGGCTCTGCAGCC 46 + 11 nt IMGT RHESUS-LMMAKL
ATGGCCTGGATTCCTCTCCTACTCCCCCTCCTCACTTTCTGCACAGGTGCTCTGCAGCC 48 + 11 nt MUSA RHESUS-LUSTXJ

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/RHESUS-VCAXRB66D/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

290 nt
TCCTATGAGCTGACACAGCCACCCTCGGTGTCAGTGTCCCCAGGACAGACGGCCAGGATCACCTGCTCTGGAGATGCATTGCCAAAAAAATATGCTTATTGGTTCCAGCAGAAGCCAGGCCAGTCCCCTGTGCTGATCATCTATGAGGACAGCAAACGGCCCTCTGGGATCCCTGAGAGATTCTCTGGCTCCAGCTCAGGGACAGTGGCCACCTTGACTATCAGTGGGGCCCAGGTGGAGGATGAAGCTGACTACTACTGTTACTCAACAGATAGCAGTGGTAATCATAG

Amino-acid sequence (V-REGION)

96 aa
SYELTQPPSVSVSPGQTARITCSGDALPKKYAYWFQQKPGQSPVLIIYEDSKRPSGIPERFSGSSSGTVATLTISGAQVEDEADYYCYSTDSSGNH

Published by the source, and consistent with the nucleotide sequence above. i