AIRBabel immunoglobulin and T-cell receptor allele sequences · leaders · RSSs

← back to search

RHESUS-VDAHPQ4OO

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMacaca mulatta LocusIGK TypeV FunctionalNone Length302 nt
SpeciesMacaca mulatta (NCBITAXON:9544)
Locus / typeIGK / V
Functional iNone
Length302 nt
Protein UID iRHESUS-VP-EWNKFZ (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (RHESUS-VDAHPQ4OO). None is canonical; they are labels, and the UID is the key.

NameSchemeSource(s)
IGKV2-NEJN*01 IgLabel MUSA
IGKV2-AEL*01 RhGLDB+ RhGLDB+

External records i

genbank:MF989452: GENBANK:MF989452

Literature references 3 total · 1 verified · 1 sequence-in-paper · 1 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMIDTitleEvidenceSource
29163486 verified MUSA
32866207 Mapping the immunogenic landscape of near-native HIV-1 envelope trimers in non-human primates. sequence in paper literature_supp
38042809 Interaction dynamics between innate and adaptive immune cells responding to SARS-CoV-2 vaccination in non-human primates. name mentioned* literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by MUSA, RhGLDB+. See Sources & citations for each source's version, citation and licence.

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/RHESUS-VDAHPQ4OO/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

302 nt
GATATTGTGATGACCCAGACTCCACTCTCCCTATCCGTCACCCCTGGAGAGCCGGCTTCCATCTCCTGCAGGTCTAGTCAGAGCCTCCTGCATAGTAATGGGTACACCTATTTGTATTGGTACTTGCAGAAGCCGGGCCAGTCTCCACAGCTCCTGATCTATGAGGTTTCCAACCGGGCCTCTGGAGTCCCTGACAGGTTCAGTGGCAGTGGGTCAGGCACTGATTTCACACTGAAAATCAGCCGGGTGGAGGCTGAGGATGTTGGGGTTTATTACTGCGAGCAAACTCTACAAACTCCTCC

Amino-acid sequence (V-REGION)

100 aa
DIVMTQTPLSLSVTPGEPASISCRSSQSLLHSNGYTYLYWYLQKPGQSPQLLIYEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCEQTLQTP

Translated here from the nucleotide sequence; no source published a protein for this allele. i