RHESUS-VE5SG6DRX

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMacaca mulatta LocusIGH TypeV FunctionalTrue Length296 nt

Species	Macaca mulatta (NCBITAXON:9544)
Locus / type	IGH / V
Functional i	True
Length	296 nt
Protein UID i	RHESUS-VP-LEUMI4 (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (RHESUS-VE5SG6DRX). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV3-4KYZ*02	IgLabel	MUSA
IGHV3-28*02	IMGT	IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

Name	Kind	Source(s)
NW_001121239.1	NCBI accession	ncbi_nucleotide

Former IMGT names i

Former name	Last seen in IMGT release
*IGHV3-1401**	2013-01-20

External records i

NCBI nucleotide: link NCBI Gene: NCBIGENE:100425798 GenBank: GENBANK:NW_001121239 IMGT: IGHV3-28*02

Literature references 2 total · 1 sequence-in-paper · 1 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
35419009	Addressing IGHV Gene Structural Diversity Enhances Immunoglobulin Repertoire Analysis: Lessons From Rhesus Macaque.	sequence in paper	literature_supp
38961347	Systematic characterization of immunoglobulin loci and deep sequencing of the expressed repertoire in the Atlantic cod (Gadus morhua).	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, MUSA, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGTGAGGGGAGGTCAGTGTGAGCCCAGACACAAACC	IMGT	RHESUS-R6AAZB

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGGAGTTTGGCCTGAGCTGGGTTTTCCTTGTTGCTATTTTAAAAGGTGTCCAGGGT	46 + 11 nt	IMGT	RHESUS-LG2GVK

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/RHESUS-VE5SG6DRX/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

296 nt

GAGGTGCAGCTGGTGGAGTCTGGGGGCGGCTTGGCAAAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTCAGTAACTACTGGATGCACTGGGTTCGCCAGGCACCAGGGAAGGGGCTGGAGTGGATCTCAGCTATTAATAGTGCTGGTAGTAGCACATACTATGCAGACTCCGTGAAGGGCAGATTCACCATCTCCAGAGAGAACGCCAAGAACACACTGTATCTTCAAATGGACGGCCTGAGAGCTGAGGACACGGCTGTCTATTACTGTGCGGGAGA

Amino-acid sequence (V-REGION)

98 aa

EVQLVESGGGLAKPGGSLRLSCAASGFTFSNYWMHWVRQAPGKGLEWISAINSAGSSTYYADSVKGRFTISRENAKNTLYLQMDGLRAEDTAVYYCAG

Published by the source, and consistent with the nucleotide sequence above. i

API: JSON · AIRR AlleleDescription · aliases