AIRBabel immunoglobulin and T-cell receptor allele sequences · leaders · RSSs

← back to search

RHESUS-VE7RUDEH2

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMacaca mulatta LocusIGH TypeV FunctionalNone Length296 nt
SpeciesMacaca mulatta (NCBITAXON:9544)
Locus / typeIGH / V
Functional iNone
Length296 nt
Protein UID iRHESUS-VP-I3GWSX (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (RHESUS-VE7RUDEH2). None is canonical; they are labels, and the UID is the key.

NameSchemeSource(s)
IGHV1-C44K*02 IgLabel MUSA
LJI.Rh_IGHV1.193_S2680 RhGLDB+ RhGLDB+

Contributed by MUSA, RhGLDB+. See Sources & citations for each source's version, citation and licence.

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/RHESUS-VE7RUDEH2/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

296 nt
CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAAGCTTCTGGATACATTTTCACCAGTTATGTTATCAGCTGGCTGCGACAGGCCCCTGGACAAGGGTTTGAGTGGATGGGAGGAATCCACCCTGGTTATGGTAGCACAAGCTACGCACAGAAGTTCCAGGGCAGAGTCACGATTACCGCGGACATGTCCACGAGCACAGTCTACATGGAGCTGAGCAGTCTGAGATCTGAGGACATGGCCGTGTATTACTGTGCAGCAGA

Amino-acid sequence (V-REGION)

98 aa
QVQLVQSGAEVKKPGASVKVSCKASGYIFTSYVISWLRQAPGQGFEWMGGIHPGYGSTSYAQKFQGRVTITADMSTSTVYMELSSLRSEDMAVYYCAA

Translated here from the nucleotide sequence; no source published a protein for this allele. i