RHESUS-VFAV7G5PK

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMacaca mulatta LocusIGH TypeV FunctionalTrue Length300 nt

Species	Macaca mulatta (NCBITAXON:9544)
Locus / type	IGH / V
Functional i	True
Length	300 nt
Protein UID i	RHESUS-VP-L22GTN (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (RHESUS-VFAV7G5PK). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV3-13*03	IgLabel	MUSA
IGHV3-13*03	IMGT	IMGT

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

Name	Kind	Source(s)
AF173904.1	NCBI accession	ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:AF173904 GenBank: GENBANK:AF173904.1 IMGT: IGHV3-13*03

Literature references 7 total · 1 verified · 6 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
10912503		verified	ncbi_nucleotide
31839985	More than one antibody of individual B cells revealed by single-cell immune profiling.	name mentioned^*	literature_supp
34764956	Novel Allele Detection Tool Benchmark and Application With Antibody Repertoire Sequencing Dataset.	name mentioned^*	literature_supp
36328595	Myeloma immunoglobulin rearrangement and translocation detection through targeted capture sequencing.	name mentioned^*	literature_supp
38643233	An ancestral SARS-CoV-2 vaccine induces anti-Omicron variants antibodies by hypermutation.	name mentioned^*	literature_supp
41617721	Refined phenotyping of vaccine responses reveals transcriptomic determinants of neutralizing antibody heterogeneity.	name mentioned^*	literature_supp
42078068	B-cell immune repertoire analysis of autoimmune neurological syndromes with anti-GAD65 antibodies.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, MUSA, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGTG	IMGT	RHESUS-R4U3NQ

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGGAGTTTGGGCTGAGCTGGGTTTTCCTTGTTGCTATATTAAAAGGTGTCCAGTGT	46 + 11 nt	IMGT	RHESUS-L6BQPI

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/RHESUS-VFAV7G5PK/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

300 nt

GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTGCAGCCTGTGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTCAGTAACTACTACATGCACTGGGTCCGCCAGGCTCAAGGGAAAGGGCTAGAGTGGGTAGGTTTAATAAGAAACAAAGCTAACAGTTACACCACAGAATATGCTGCGGCTGTGAAAGGCAGATTCACCATCTCAAGAGATGATTCAAAGAACACGCTGTATCTGCAAATGACCAGCCTGAAAACCGAGGACACAGCCCTGTATTACTGTACTAAA

Amino-acid sequence (V-REGION)

100 aa

EVQLVESGGGLVQPVGSLRLSCAASGFTFSNYYMHWVRQAQGKGLEWVGLIRNKANSYTTEYAAAVKGRFTISRDDSKNTLYLQMTSLKTEDTALYYCTK

Published by the source, and consistent with the nucleotide sequence above. i

API: JSON · AIRR AlleleDescription · aliases