RHESUS-VGVWAD2GA

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMacaca mulatta LocusIGH TypeV FunctionalNone Length297 nt

Species	Macaca mulatta (NCBITAXON:9544)
Locus / type	IGH / V
Functional i	None
Length	297 nt
Protein UID i	RHESUS-VP-SNFLT7 (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (RHESUS-VGVWAD2GA). None is canonical; they are labels, and the UID is the key.

Name	Scheme	Source(s)
IGHV3-182*02	IMGT	IMGT

Former IMGT names i

Former name	Last seen in IMGT release
*IGHV3-801**	2013-01-20

External records i

IMGT: IGHV3-182*02

Literature references 6 total · 6 name-mentioned* i

PubMed publications linked to this allele. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMID	Title	Evidence	Source
35419009	Addressing IGHV Gene Structural Diversity Enhances Immunoglobulin Repertoire Analysis: Lessons From Rhesus Macaque.	name mentioned^*	literature_supp
38961347	Systematic characterization of immunoglobulin loci and deep sequencing of the expressed repertoire in the Atlantic cod (Gadus morhua).	name mentioned^*	literature_supp
39698082	Comprehensive method for producing high-affinity mouse monoclonal antibodies of various isotypes against (4-hydroxy-3-nitrophenyl)acetyl (NP) hapten.	name mentioned^*	literature_supp
40338637	Comprehensive analysis of nasal IgA antibodies induced by intranasal administration of the SARS-CoV-2 spike protein.	name mentioned^*	literature_supp
41410768	Convergent mutation trajectories convert functional self-tolerance in IGHV4-34 B cells to genetic tolerance encoded in the antibody.	name mentioned^*	literature_supp
41876881	Development of canine parvovirus-neutralizing monoclonal antibodies from natural host and their germline gene usage.	name mentioned^*	literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

Part	Sequence	Source	RSS UID
v_rs	CACAGTGAGGGGAAGTCAGTGTGAGCCCAGACACAAACC	IMGT	RHESUS-REXGWW

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)	Split	Source	Leader UID
ATGGAGTCTGGGCTGAGCTGGGTTTTCCTTGTTGCTATTTTAAGAGGTGTCCAGTGT	46 + 11 nt	IMGT	RHESUS-LFOXRA

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/RHESUS-VGVWAD2GA/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

297 nt

GAGGTGCAGCTGGTGGAGTCTGGAGGAGGCTTGGTCCAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTCAGTAGCTATGGCATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCATACATTAGTAAATGGTGGTGGTAGCACATACTACGCAGACTCCGTGAGGGGCCGATTCACCATCTCCAGAGACAACTCAAAGAACACGCTCTCCCTGCAAATGAACAGCCTGAGAGCTGAGGACACGGCCGTGTATTACTGTGCGAAAGA

Amino-acid sequence (V-REGION)

99 aa

EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWVSYISKWWW*HILRRLREGPIHHLQRQLKEHALPANEQPES*GHGRVLLCER

Translated here from the nucleotide sequence; no source published a protein for this allele. i

API: JSON · AIRR AlleleDescription · aliases