AIRBabel immunoglobulin and T-cell receptor allele sequences · leaders · RSSs

← back to search

RHESUS-VHWXGI4Z5

AIRBabel's deterministic identifier, minted from the sequence (SPECIES-CODE+hash) i: a stable sequence-derived identifier, not an official allele name. This sequence's names from each source are listed under Allele names.

SpeciesMacaca mulatta LocusIGH TypeV FunctionalTrue Length296 nt
SpeciesMacaca mulatta (NCBITAXON:9544)
Locus / typeIGH / V
Functional iTrue
Length296 nt
Protein UID iRHESUS-VP-ULS5FH (shared by alleles with the same V-REGION amino-acid sequence)

Allele names i

Every name below denotes this exact sequence (RHESUS-VHWXGI4Z5). None is canonical; they are labels, and the UID is the key.

Multiple allele designations. This one sequence is recorded under 2 different allele designations: IGHV4-160*05, IGHV4-117*01_S6852. These are identical normalized nucleotide sequences with different attributed names.

NameSchemeSource(s)
IGHV4-2ZSG*02 IgLabel MUSA
IGHV4-YE26*14 IgLabel OGRDB
IGHV4-160*05 IMGT IMGT
IGHV4-117*01_S6852 KIMDB KIMDB

Other names & identifiers

Alternative and former names, e.g. IMGT clone names, plus accession identifiers.

NameKindSource(s)
MT542387.1 NCBI accession ncbi_nucleotide

External records i

NCBI nucleotide: link GenBank: GENBANK:MT542387 GenBank: GENBANK:MT542387.1 IMGT: IGHV4-160*05 OGRDB: IGHV4-YE26*14

Literature references 4 total · 1 verified · 2 sequence-in-paper · 1 name-mentioned* i

PubMed publications linked to this allele. A sequence-in-paper match indicates that this allele's exact sequence was detected in the publication text or supplementary material; it is sequence-level evidence. Name-mentioned entries were auto-collected by name match and may refer to a different same-named allele; treat them as leads, not ground truth.

PMIDTitleEvidenceSource
33484642 verified ncbi_nucleotide
35419009 Addressing IGHV Gene Structural Diversity Enhances Immunoglobulin Repertoire Analysis: Lessons From Rhesus Macaque. sequence in paper literature_supp
41392054 Necessity of individual VDJ-databases for annotating antibody heavy chain characteristics in non-human primates. sequence in paper literature_supp
36405682 Primary antibody response after influenza virus infection is first dominated by low-mutated HA-stem antibodies followed by higher-mutated HA-head antibodies. name mentioned* literature_supp

* matched by allele name only. The publication mentions this name, but AIRBabel cannot determine from the name alone whether it refers to this allele; the same name can denote a different allele in another species. This is useful for literature review but is not verified evidence.

Contributed by IMGT, KIMDB, MUSA, OGRDB, ncbi_nucleotide. See Sources & citations for each source's version, citation and licence.

RSS i

Recombination signal sequences flanking this allele. Click one to see every coding allele linked to that exact RSS variant.

PartSequenceSourceRSS UID
v_rsCACAGTGAGGGGAGGTGGGTGTGAGCCCAGACA IMGT RHESUS-R52DZZ

Leader

Signal-peptide coding sequence (spliced exon 1 + exon 2). The genomic intron between the two exons is deferred.

Leader (exon 1 + exon 2)SplitSourceLeader UID
ATGAAGCACCTGTGGTTCTTCCTCCTGCTGGTGGCAGCTCCCAGATGGGTCCTGTCC 46 + 11 nt IMGT RHESUS-LKPWHA

Find similar alleles

Ranks coding alleles by normalized edit-distance identity. Also available at /api/sequences/RHESUS-VHWXGI4Z5/similar?min_identity=0.95&kind=nt.

Coding sequence (nt)

296 nt
CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGGAGACCCTGTCCCTCACCTGCGCTGTCTCTGGTGGCTCCATCAGCAGTAACTACTGGAGCTGGATCCGCCAGCCCCCAGGGAAGGGACTGGAGTGGATTGGACGTATCTATGGTAGTGGTGGGAGCACCGACTACAACCCCTCCCTCAAGAGTCGAGTCACCATTTCAACAGACACGTCCAAGAACCAGTTCTCCCTGAAGCTGAGCTCTGTGACCGCCGCGGACACGGCCGTGTATTACTGTGCGAGAGA

Amino-acid sequence (V-REGION)

98 aa
QVQLQESGPGLVKPSETLSLTCAVSGGSISSNYWSWIRQPPGKGLEWIGRIYGSGGSTDYNPSLKSRVTISTDTSKNQFSLKLSSVTAADTAVYYCAR

Published by the source, and consistent with the nucleotide sequence above. i